KEGG   Yersinia pestis D182038: YPD8_2242Help
Entry
YPD8_2242         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
  KO
K07146  UPF0176 protein
Organism
ypx  Yersinia pestis D182038
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    YPD8_2242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese_C Rhodanese Glyco_hydro_85
Motif
Other DBs
NCBI-ProteinID: ACY62917
Position
2857544..2858611
Genome map
AA seq 355 aa AA seqDB search
MPVLHNRISNEELKARMLAETEPRTTVSFYKYFTLEDAKTFRDNLYSQFVKLGVFGRVYV
AKEGINAQISVPANRYDEFKIALFASHPALDQVRLNVAHEDDGKSFWVLRLKVRERIVAD
GIDDDSFDPANIGHYLKADQVNQMIDDPDTLFVDMRNHYEYEVGHFENAIEVPSDTFREQ
LPMAVDMLQHDKEKNIVMYCTGGIRCEKASAYMLHNGFKNVYHVEGGIIEYARKAKEQGL
PLKFIGKNFVFDERMGERISDDVIAHCHQCGTPCDAHTNCKNDGCHLLFIQCPVCAAKFE
GCCSQICQEELKLPQEEQRSRRAGRENGIKIFNKSKGLLQATMHIPSPEKSADEK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgccagtgttacataaccgaatttctaatgaggaactcaaagcgcgtatgttggctgaa
accgagccgcgcaccacagtttctttttataaatacttcactctggaagatgctaaaacc
ttccgtgataacctctatagccaatttgttaagctcggtgtttttggccgcgtctatgtg
gcaaaagagggtatcaatgcacagatcagcgtccccgcgaatcgatatgatgaatttaaa
atcgcgctgtttgcctcacaccctgcgctggatcaagtacggttgaatgttgcgcacgaa
gatgacggtaaatcattttgggttttgcgcctgaaagttcgtgagcgcattgtggctgat
ggcattgatgatgacagctttgatcctgccaatatcgggcactatctgaaagccgatcag
gtcaatcagatgattgatgatccagatacgttgtttgttgatatgcgtaaccactatgaa
tacgaagtgggccattttgaaaacgcaatagaagtcccttcggatacattccgtgaacaa
ctgccgatggcggttgatatgctgcaacatgataaagagaagaatattgtcatgtattgc
accggggggatccgttgcgagaaagccagtgcttatatgctgcacaatggcttcaaaaat
gtttatcacgttgaaggcggcattattgaatatgcacgtaaagcaaaagagcaggggcta
ccactgaaattcatcggcaaaaattttgtgttcgatgaacggatgggggaacggatttct
gatgatgtcatagcgcactgccatcaatgtggaacgccttgtgacgcgcataccaactgt
aaaaacgatgggtgccacttactgtttatccagtgtccagtgtgcgcggcgaagtttgaa
gggtgttgtagccagatttgccaggaagagctgaaactgccacaggaagagcaacgctcc
cggcgggcagggcgtgaaaatggcattaagatttttaataagtctaaagggttgttgcaa
gccaccatgcacattccctcgccagaaaagagtgcggatgaaaagtag

DBGET integrated database retrieval system