KEGG   Yersinia pestis D182038: YPD8_2254Help
Entry
YPD8_2254         CDS       T01833                                 

Definition
(GenBank) putative thiamine pyrophosphate-dependent protein
  KO
K03336  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing) [EC:3.7.1.22]
Organism
ypx  Yersinia pestis D182038
Pathway
ypx00562  Inositol phosphate metabolism
ypx01100  Metabolic pathways
ypx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    YPD8_2254
Enzymes [BR:ypx01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.22  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (ring-opening)
     YPD8_2254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C TPP_enzyme_N TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: ACY62929
Position
2879567..2881513
Genome map
AA seq 648 aa AA seqDB search
MSTVNMAMKTVRMTMAQALVRFLNQQYVAIDGQEVAFVHGVMTIFGHGNVLGIGQALEEN
PGHLQVHQGCNEQGMAHMAIGFAKQYRRQRIYAVSSSIGPGAANMVTAAATATANRIPLL
LLPGDIYASRQPDPVLQQIEQYHDLSISTNDCFRPVSRYWDRINRPEQLMSAMLSAMRVL
TDPADTGAVTLCLPQDVQGEAWDYPASFFERRVHRIERRPPDTRRLSDALSLIARKRRPL
VVCGGGVRYSGAHEAFRAFVENAQLPFTETQAGKGALPSDHPLNLGGIGVTGGLAANRLA
PQADLVIGIGTRLTDFTTGSKALFSHPEVAFLLLNVAEFDALKLDATALIADARVGLEAL
TEGLAGYRTAWQGDIIEAKAAWCDECQRLWSRTWRPDEVPEVAGHLDDSLQEYAEVLNTT
LTQTRVLGLINQHIEDDAIVVGAAGSLPGDLQRLWQVKTADTYHLEYGYSCMGYEIAAAI
GAKIAMPHQPVYAMVGDGSYMMLHSELHTAVQEGLKITVLLFDNAGFGCINNLQMGHGMG
SFCTESRHRNHESGQLNGPLICVDFAQNAESYGCRAWRVHDEPSLLAALAASRDHPGPVL
LDIKVLPKSMTHDYASWWRTGDAQIARSPAVQQAAERTQMKVKRARQY
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgtaaacatggcgatgaaaacagtacggatgaccatggcacaggcgctggtc
aggtttcttaatcagcaatatgtggccattgatggtcaggaggtcgcatttgtccacggc
gtgatgacgattttcgggcacggcaatgtactcggtatcggccaggctctggaagaaaat
ccgggccatttacaggtgcatcagggctgtaacgagcagggcatggcgcatatggcgatt
ggttttgcgaaacagtatcgccgtcagcgtatctatgccgtcagttcgtctatcgggccg
ggagccgccaatatggtcaccgcagcggccaccgccacggcaaaccgcattccgctgctg
ctattgccgggggatatctacgccagccgtcagcctgacccggtgttacagcagatcgag
caatatcacgaccttagtattagcactaacgattgcttccgcccggtatcacgttactgg
gatcgcattaatcgccctgagcaattgatgagcgccatgctgagtgctatgcgagtactg
actgacccggcggataccggtgcggtgaccctttgtctgcctcaggatgtgcagggcgaa
gcgtgggattacccggcgagcttctttgagcgccgggtgcatcgtatcgagcgccgtcca
ccggatacgcgcaggctttctgatgcgctcagcctgatcgcccgtaaacgccgcccgctg
gtggtgtgtggcggcggcgtgcgctattcgggggcgcatgaggcgtttcgtgcctttgtg
gaaaacgctcaattaccctttactgaaacccaagcgggcaaaggggcgctgccaagtgat
catcccctcaacttggggggaattggtgtcactggcgggttggccgctaaccggttagct
ccacaggctgatctggtgatcggcatcggtacccggctcaccgatttcactacgggttcc
aaagcactattttctcacccggaggtggcgtttttgctgcttaacgtggcggaattcgat
gcacttaaactggatgccacggccctgattgccgatgcgcgggtggggcttgaggcatta
accgaagggctggcaggttatcgcactgcttggcagggcgatatcattgaggccaaagca
gcgtggtgcgacgaatgtcaacggctttggtcacgcacctggcggcctgatgaggtgcca
gaggtggccggtcatcttgatgattcgctacaagaatacgccgaggtgctcaataccaca
ctgacccagactcgggtacttgggcttatcaaccagcatattgaagacgatgccattgtc
gtgggggcggcggggtcgctgccgggggatttacagcgtctatggcaggtaaaaacggca
gacacctatcatcttgaatacggttattcatgcatgggctatgaaatcgctgccgccatc
ggggcgaaaattgcgatgccacatcaaccggtgtacgccatggtgggtgatggctcctat
atgatgctgcattccgagctgcacacggcggtacaagaggggctaaaaattaccgtccta
ctgtttgataacgccggattcggctgtatcaacaacctgcaaatgggccacgggatgggc
agtttttgtaccgagagccgccaccgtaaccacgagtcggggcaactcaatggcccattg
atttgcgttgatttcgcccaaaacgccgaaagttatggctgccgcgcctggcgggtgcac
gatgaaccaagcctgctagcggcattggcagcatcccgcgatcatccggggccggtgcta
ctggatattaaagtcttgccgaaaagcatgacgcacgattatgcgtcttggtggcgtact
ggcgatgcgcaaatcgcccgttcacccgcggtacagcaggctgcagagcgaacccagatg
aaggtaaaacgtgcccgtcagtactaa

DBGET integrated database retrieval system