KEGG   Yersinia pestis D182038: YPD8_2555
Entry
YPD8_2555         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
ypx  Yersinia pestis D182038
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypx02044]
    YPD8_2555
Secretion system [BR:ypx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPD8_2555
SSDB
Motif
Pfam: GPW_gp25 Fur_reg_FbpB
Other DBs
NCBI-ProteinID: ACY63228
Position
complement(3244381..3244860)
AA seq 159 aa
MEKKKQFLPALLERLLDDEPKKHIEPHDKFFYDSRTMRKLVQRNISEILNNANIEDRLDP
QRHKWVATSVLNYGISPLVGLYAVPHNWATIERIIREAIIRFEPRIMAESLVVSQQLQAR
NGIIQFEIRGLIKWNPHPIDLCIEGAYDVETDNAELRAR
NT seq 480 nt   +upstreamnt  +downstreamnt
atggaaaagaaaaaacagtttttaccggcgttgttagagcgtttactcgatgatgagcct
aaaaagcatattgagcctcacgataaattcttttatgactcacggacgatgcggaaattg
gtacaacgtaatatttcagagatattaaataatgccaatattgaagaccggttggatccg
cagcgtcataaatgggtagcgacgtcggtcttaaactatggtatttcacccctggtcggg
ctttatgccgtgccgcataattgggcgactattgaacgaattatcagagaggccattatc
cgttttgaaccacggataatggcggaatctctcgttgtcagccagcaactccaggccagg
aatggcattatacagtttgagattagggggttaatcaaatggaacccgcaccctatcgat
ctttgtattgaaggtgcctatgacgttgagacggataacgcagagctacgcgcccgttga

DBGET integrated database retrieval system