KEGG   Yersinia pestis D182038: YPD8_2568
Entry
YPD8_2568         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ypx  Yersinia pestis D182038
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypx02044]
    YPD8_2568
Secretion system [BR:ypx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPD8_2568
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACY63241
Position
complement(3261466..3261990)
AA seq 174 aa
MVSKSNSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPSVADR
KLLDIDIDNFDERMKAMKPRVAFAVLNTLTGEGQLMVDITFESMDDFSPDAIAKKVDSLS
QLLDARTQLANLQTYMDGKAGAEELVMKLLKDKSLLTTLASAPKAKQSAVDTPQ
NT seq 525 nt   +upstreamnt  +downstreamnt
atggttagcaaaagtaattctcaaaagtttatcgctcgaaaccgagcgccacgcgtgcag
attgaatacgatgtggaaatatacggtagtgaaaagaaggttgaattacctttcgttatg
ggggtattagcagatttatccggtaaacctcttgagcctttaccttcagtcgctgacaga
aaactgttagatatcgatattgataatttcgatgagcgcatgaaagcaatgaaaccacgt
gttgcattcgccgtgctgaatacattgactggggaaggccagttaatggtcgatattacg
tttgagagtatggatgatttctctcctgacgctatcgcgaaaaaagttgattcattgtct
caattattagatgcccgaactcaacttgccaacttgcagacttatatggatggtaaggct
ggtgctgaggaattagttatgaaattgctgaaagacaaatcattactgacaacgcttgca
tccgcaccgaaagcaaaacaatccgctgttgatactccacagtaa

DBGET integrated database retrieval system