KEGG   Yersinia pestis D182038: YPD8_2941Help
Entry
YPD8_2941         CDS       T01833                                 

Definition
(GenBank) stationary-phase survival protein
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
ypx  Yersinia pestis D182038
Pathway
ypx00230  Purine metabolism
ypx00240  Pyrimidine metabolism
ypx00760  Nicotinate and nicotinamide metabolism
ypx01100  Metabolic pathways
ypx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YPD8_2941
   00240 Pyrimidine metabolism
    YPD8_2941
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    YPD8_2941
Enzymes [BR:ypx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     YPD8_2941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: ACY63613
Position
complement(3723860..3724609)
Genome map
AA seq 249 aa AA seqDB search
MSNDDGISAPGIQTLASALRGFAQVQIVAPDRNRSGASNALTLDSALRITTLSNGDIAVQ
QGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGYPALAVS
LNGHQHYDTAAAVTCRLLRALQRKPLRTGKILNINVPDLPLAEIKGIRVTRCGSRHPAEQ
VFCQQDPRGQDLYWIGPPGEKYDAGPDTDFAAVEQGYVSITPLQVDLTAYMAQEVVESWL
ANTEVDGEW
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaacgatgatggtatttctgcgccagggatccagacgctggccagtgcattgcgg
ggatttgctcaggtgcaaattgtggcacccgatcgtaaccgtagtggcgcttccaatgca
ttgactctggatagtgcattgcggatcactaccttatctaatggtgatattgcggtgcag
caagggacccccaccgattgcgtctatctgggtgtgaatgcgctgatgcgcccacggcct
gacatcgttgtctctggtattaatgctggccctaatttaggggatgatgttatctattcg
ggtaccgtagcagcggcgatggaagggcgtcatttgggatacccagccttggctgtctcg
ctcaacggtcatcagcattacgatacggcggcggcagtgacttgccgtttattacgtgcg
ttacagcgcaaaccactgcgtaccggcaagatcctcaatataaatgttcctgatttgcct
ttagcggaaattaaagggattcgggtgacgcgttgtggtagccgccatccggcagagcag
gtattttgtcagcaagatcccagagggcaagatctttattggatcgggccgccgggtgaa
aagtatgatgcagggccagatactgactttgcggcggttgaacaaggttatgtatcaata
acgccgcttcaagtcgatttaacggcttatatggcacaagaagtggttgaaagttggtta
gccaatactgaggttgacggggaatggtaa

DBGET integrated database retrieval system