KEGG   Yersinia pestis D182038: YPD8_3234Help
Entry
YPD8_3234         CDS       T01833                                 

Gene name
vgrG6
Definition
(GenBank) putative Rhs accessory genetic element
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ypx  Yersinia pestis D182038
Pathway
ypx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPD8_3234 (vgrG6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypx02044]
    YPD8_3234 (vgrG6)
Secretion system [BR:ypx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPD8_3234 (vgrG6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Gp5_C gpW
Motif
Other DBs
NCBI-ProteinID: ACY63904
Position
complement(4081795..4083993)
Genome map
AA seq 732 aa AA seqDB search
MFAHDKANNNKTADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGIGDAVGGTAGKRINQA
AEVAKTALDAKAKVLDGGVTPLNLAAGGAGAGLPDSAAAALTRLVKQPSGLQFTLTTASL
PPQTFAVVDFTLSEMLSSPFVLNVGLASADPAVDFAAVLDEDATLFIWREGVLQRSITGM
VASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQASVEEIITTLLKENGINDFAFG
FRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGKNTVVYADDVGSLPKGASLP
YNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGELQNQRPDYEH
FDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAW
QLLGVQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGP
PGEEIYCDEYGRIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDF
LHGDPDQPIVTGRTYHANNIPPGSLPASKTQMAFRSKTHQGEGYNEMRFEDAKGGEGLFM
HAQKDMSTTVKDNQTTTVEKGNQTVTVEKGDRTVTVATGNETTDITQGSLTETIKVRRST
CANFIQVKAEGDAPGTQLYTATEQIKFVVGKSSITLNPDSIILQFSGSTSITLNAANIDA
IAPLINLNKDKG
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctcatgataaagctaataataataaaaccgcggacaagaccggcacggtgacg
ccgacccatatcgtctcgccggaggccgccccaaccgtgagtggcgctcagatgaccgag
atggccggggggattggggatgcggtgggcggcactgccggtaagcgcattaatcaggcc
gccgaggtggctaaaaccgccctggatgccaaagcaaaagtcctggacggcggcgtcacg
ccgctgaatctggccgcgggcggggccggtgcgggattaccggacagcgccgcggcggcg
cttacccgcctggtcaaacagccctccggcctgcaatttaccctgacgacggccagttta
ccgccccagacctttgcggtggtggatttcaccctgagtgagatgctctcctcgccgttt
gtgctcaatgtcgggctggcgagtgccgatccggcggtggattttgcggcggtgctggat
gaagacgccacgctgtttatctggcgcgaaggggtgctgcaacgcagcatcaccggcatg
gtcgccagctttgaacagggcgataccggttttcatcagacccgctacagcatggtgatc
cgcccggcgctgtggcgcaccagcctgcggcgcaatgcccgcatcttccagcaggcctcg
gtggaagagatcatcaccaccctgctgaaagagaacggcatcaacgattttgcctttggt
tttcgccacccgcacccggtgcgcgagttctgcgtgcaatatcaggagtccgattttgat
tttatccagcgcctgacggcagaagaggggattttctactacttcgagttcagcgccggg
aaaaataccgtggtgtatgccgatgatgtcggctccctgccgaaaggcgcgtcactgccc
tataacccgaatgtggcggcgcaggcgcaggaactgagtatcaccaccttcacccgcagt
gcgcaggtgcgcccggcgatggtgcaactgaaggactacacctttaaaaacccgaactgg
gccgcggccttcagcgaacagtcgggagaactgcaaaaccagcgaccggactacgagcat
tttgattttccggggcgcttcaaagatgcccagcacgggcaggattttacccgctaccgg
ctggatgcactgcgcaatgacgccaatctggggcagggggcgagcaatgattttaccctc
cagccggggcagttgttcagcctgtacaaccacccgcgtggtgatctgaaccacgcctgg
cagttgctcggcgttcagcacagcggcaaacagatgcaggcgctggagcaggcgtctggc
gatcagggcacggtgctgttcaaccacttcagttttattccgcacacccagacctggcgg
ccgacgccgctggcgaaaccggcgatggacggcccgcagatcgccatggtggtggggcca
ccgggggaagagatttactgcgacgaatacgggcgcatccgcctgcaatttttatgggat
cgctacgggcagagcaatgacaacagctcctgctggatccgggtaacccagccgtgggcg
ggccagggctggggcatgctggccattccgcgtattggtcaggaagtggtggtggatttt
ctgcacggcgatccggatcaaccgattgtcacggggcggacctatcacgccaacaacatc
ccgccggggtcgttaccggccagtaaaacccagatggcgttccgctcaaaaacccaccaa
ggggaaggctacaacgaaatgcgcttcgaggatgccaaaggcggcgaagggctgtttatg
catgcgcagaaagatatgagtaccacggtaaaagataaccagacgacgacggtggagaaa
ggtaatcaaaccgtcaccgtagaaaaaggtgacaggacagtcacggtcgcgaccggaaat
gaaaccacagatattacccaagggagcctgaccgagacgatcaaagtgcgtcgcagtacc
tgcgcgaattttattcaggtgaaggctgaaggtgatgcgcctggtacgcaactttatacc
gcgacggaacagataaagttcgtggtgggcaagagcagcattaccttaaatccggactct
attattctgcaattttctggctctacctctattacgctgaatgccgccaatattgacgcc
atcgcgccattgattaacttaaataaagacaagggataa

DBGET integrated database retrieval system