KEGG   Yersinia pestis D182038: YPD8_3243Help
Entry
YPD8_3243         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ypx  Yersinia pestis D182038
Pathway
ypx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPD8_3243
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypx02044]
    YPD8_3243
Secretion system [BR:ypx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPD8_3243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: ACY63913
Position
complement(4094451..4096385)
Genome map
AA seq 644 aa AA seqDB search
MGLYQGNNIGPYVESTYLQLLQQRFVPALMSGLLEQLNAAPKGSEEKLEILRVMRMLEDG
SGRNAALVEQYMSHRWSQQFNGQRELQEQLSSHLNYALKHTDWHGARESGDQYAIKSFVP
YLRPIQSAQQELSKLSIYQRVYQNLRIKAQDALPPALDLRDQIGASFDDIFVSGNDRLLV
IPQFLTRSGLQSYFIKQNDQLVDLTVMDSWVLNLTKNVEYSEADRKEIHRQVTEQYLGDY
TATWRAAMNNLSVSDFEGLPQAISAIEQVISGEQPFRRALQTLSDNTRLPVISDLIPAKE
QQELLQKPDYLLLTRINREFSPETAVLVENGDKGSVIQSVYQKLTELHRYLLAIQNSPAP
GKAALKAVQLRLDQNNSDPIFEVQQLAKNLPEPLNRWVGELAEQAWRVVMMEAIQSLEVE
WNETVIKQYQTYLAGRYPFDPHAKQDVPLSEFERFFGPKGTLDAFYQQNLKPFVENNLTG
GSDGELLIRPDVLQQLAQARKIRDTFFSAQNGLGTQFAIEPVLLSGNKRRSVLNLDGQLL
DYAHGRSGVVHLVWPNSMRAGVESKLTLVPDESGKSPRTLSFSGPWAQLRLINAGELTNV
GTNSFDVRFKVDGGEMTYRIFVDESDNPFAGGLFSKFSLPDTLY
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggggttatatcagggcaataatatcgggccttatgtcgaaagcacttacttgcaactc
ctacagcaacgttttgtcccggcactgatgagcgggctgttagaacaactgaacgccgcg
ccgaagggcagtgaagagaaactggaaattctgcgggtgatgcggatgttggaagacggc
agtggccgcaatgccgcgctggttgaacaatatatgagccaccgctggagccaacaattc
aacggccagcgcgagttgcaggagcaactgtcgagccacctgaactacgcactgaaacac
accgactggcacggcgcacgggaaagtggcgatcaatatgcgatcaagagctttgttccg
tacctccgcccgatccagtcagcgcagcaagagttgagcaaactctcgatctaccaacgg
gtgtatcagaacctgcggatcaaagcacaggatgcgttgccgcccgcgctcgatttgcgc
gatcagatcggcgcaagttttgacgacatctttgtctccggtaacgatcgcctgctggtg
atcccgcaattcctgacccgtagcggcttacagagttacttcatcaaacagaacgatcaa
ctggttgatctcacggtgatggacagttgggtacttaatctcaccaagaacgtcgaatac
agcgaggcagaccgcaaagagatccatcgccaggtgaccgaacagtatcttggcgattat
accgccacctggcgtgcggctatgaataacctgtcggtcagtgattttgaaggcttgcca
caggcgatcagcgccattgaacaggtgatcagcggggaacaacctttccgccgtgcactg
caaacgctgagtgacaacacccgcttgccggttatctcggatctgatccccgcgaaggag
cagcaagagctgctgcaaaaacccgattacctgctgctgacccgcatcaaccgtgagttc
tcccccgaaacggcggtgctggtggagaatggcgataaaggcagcgtgatccaaagtgtt
taccaaaaactgaccgagctacaccgctatctgttggcgatccaaaactcgcccgcgccg
ggcaaagcggcgttgaaggcggtgcaattacgtctggatcaaaacaacagtgatccgatt
tttgaagtccagcaactggctaaaaacctgccggagccgctaaaccgttgggtgggcgaa
ctggcagagcaagcctggcgggtggtgatgatggaggcgatccagtcactggaagtggag
tggaatgagacggtgatcaaacagtatcaaacctacctggccggacgttatcccttcgat
cctcacgcgaaacaggatgtaccactcagtgagtttgaacgcttcttcgggccgaaaggc
acgctcgatgcattctatcagcagaacctgaaaccgtttgtcgaaaacaacctgaccggt
ggcagcgatggcgaattgctgatccggcctgatgtgttacagcaactggcgcaggcacgg
aaaattcgcgacaccttcttctcggcccaaaacggcctgggcacacagtttgcgattgaa
ccggtgctgttaagtggcaacaagcgccgcagcgtattgaatctggatgggcaattactg
gattacgcccatggccgcagcggcgtagtgcatctggtttggccaaactcgatgcgtgca
ggagtggaaagcaaactgacgttagtcccggatgagagcggcaaatcaccgcgcaccctc
agcttcagcggtccttgggcgcagttgcggctgatcaacgccggtgaactgaccaatgtg
ggcaccaactccttcgatgtccgcttcaaggttgatggcggcgagatgacgtaccgcatc
tttgttgatgaatccgacaacccattcgcgggcggtttgttcagtaaattcagtctgcca
gacactctgtattga

DBGET integrated database retrieval system