KEGG   Yersinia pestis D182038: YPD8_3377Help
Entry
YPD8_3377         CDS       T01833                                 

Gene name
pldB
Definition
(GenBank) putative lysophospholipase
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
ypx  Yersinia pestis D182038
Pathway
ypx00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YPD8_3377 (pldB)
Enzymes [BR:ypx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     YPD8_3377 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 LIDHydrolase Abhydrolase_5 Peptidase_S15 DLH
Motif
Other DBs
NCBI-ProteinID: ACY64045
Position
complement(4270889..4271902)
Genome map
AA seq 337 aa AA seqDB search
MLLGHHMNNWLTREEQFAAFINGPLLDFWQQRDEQTFMGVDNIPIRYVRFRAPHHTQVVV
VVPGRIESYVKYPEVAYDLFQQGYDVIVLDHRGQGRSGRMLDDHNRGHVIKFDDYIEDFA
QLVQIEITGSHYQQRFALAHSMGGAILTRFLAREPDVFNAVALCAPMFGIHLPLPGWLAR
RIVNWAEGHQKLRDYYAIGTGHWRPLPYLVNMLTHSRERYRRYLRQYSDTPEIRVGGPTY
HWLRESLLVGEQIIAEAEKITTPVLLLQASEDRVVHNPAHDAFSQAMTLAGHPCEGGRPQ
VIQGARHEILFERDTLRAEALSAILRFFAQHQSSVGH
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgctgttaggtcatcacatgaataattggttaacccgagaagagcaatttgctgctttt
attaatgggccattgttggatttctggcagcaacgagacgaacagacgtttatgggcgtc
gataatatccccattcgctatgtccgttttcgtgcgccgcatcatacccaagtcgtggtg
gtagtgccggggcgtatcgaaagttacgtcaaataccctgaagttgcttatgacctgttc
cagcagggctatgatgtgatagtgctggatcatcgcgggcaagggcgttctgggcgtatg
ctggatgatcataaccgtggtcacgtgattaagttcgatgactatattgaggattttgca
caactggtgcagatcgaaattaccggtagccattatcagcagcgttttgcgctggcccac
tcaatggggggcgcgattctgacgcgttttctagccagagagcctgatgtatttaatgcc
gttgcgttatgtgcgcccatgtttggtattcatttacccctgccgggctggttggcacgc
cgtattgttaactgggccgaagggcaccaaaagctacgggattattacgcgattggtact
gggcattggcggccactgccgtatttggtcaatatgctgactcacagccgcgagcgttat
cgccgctatttgcgccaatattcagacacaccagaaatccgcgtgggtggccccacttac
cattggctacgtgaaagtttgctggtgggggagcaaattattgctgaagcggagaaaatc
accactccggtattattgttacaggccagtgaggatcgggtggttcataacccagcccac
gatgctttttctcaggcaatgacattggcagggcacccctgtgaaggggggcgtcctcag
gtcattcaaggcgcacgccatgagatcctgtttgagcgggacacgctgcgtgccgaggcg
cttagcgccatattgcgctttttcgcgcaacatcaatcatcagtcggccattag

DBGET integrated database retrieval system