KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_0027Help
Entry
YPK_0027          CDS       T00665                                 

Definition
(GenBank) Mannitol dehydrogenase domain
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Pathway
ypy00051  Fructose and mannose metabolism
ypy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    YPK_0027
Enzymes [BR:ypy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     YPK_0027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh ApbA 3HCDH_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ACA66341
UniProt: B1JH11
Position
31616..32779
Genome map
AA seq 387 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGAQLTFADVNQPLLDALNKRKRYQVNVVGEQARVEEV
KNVSAVNSGSPEVVALIAEADIVTTAVGPQILARIAATVAQGLITRHQQGNTRPLNIIAC
ENMVRGTSQLKQHVFAALSEDEQIWVEQHVGFVDSAVDRIVPPSEAGSTDILAVTVETFS
EWIVDGTQFKGQPPEIVGMELTDNLMAFVERKLFTLNTGHAITAYLGQLAGHQTIRDAIL
DPAVRQTVKGAMEESGAVLIKRYAFDPQKHAAYINKILSRFENPYLHDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYQLPHDSLVTGIAAAMSYRSEQDPQAQELVTLLAQLGPKAALAQ
ISGLPADSEVVEQAVSVYNAMQQKLAH
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcagggaatattggccgtggcttcatcggcaaactgctc
gcggatgccggtgcgcaactgaccttcgccgatgtgaatcaaccgttgttggatgcactg
aataaacgtaaacgttatcaggtcaatgtggtcggtgaacaggctcgggttgaagaggta
aagaatgtcagtgcggtaaacagcggtagcccggaagtggttgcgctgattgctgaggcc
gatattgttaccaccgctgttggcccacaaattttggccagaattgcggcgacagtggca
cagggtctgatcactcgacatcagcaagggaatacccgcccactgaatattattgcctgc
gaaaatatggtgcgtggcactagccaattaaaacaacatgtgtttgctgccttatcagaa
gacgaacaaatatgggtagagcagcatgtgggttttgtggattcggcagtcgatcgtatt
gtcccaccatcagaagcgggcagtactgatatcctggctgtcacggtagaaacctttagc
gaatggatagtcgacggtacccaatttaaaggccagccacccgaaatcgtgggtatggaa
ttgaccgataatctcatggcttttgtcgagcgtaagctcttcacgttgaacaccgggcat
gctattaccgcgtatctgggccaactggcaggccatcaaacgatccgcgatgcgattctc
gacccggcggtacgtcaaacagtaaaaggtgcgatggaagagagcggtgcggtactgatt
aagcgttatgctttcgacccacagaaacatgcggcttatatcaacaaaattctctctcgt
tttgaaaacccttatttgcacgatgatgtcgagcgggttggccgtcaaccactgcgtaag
ctgagcgccggtgatcgtttgatcaaaccgctgctaggcacgctggagtatcaattgccg
cacgattctctggtaacgggtattgccgccgccatgagctatcgcagtgagcaagatcca
caggcccaagagttggtgacgttattggcacaattagggccgaaagctgcgttagcgcaa
atttcaggcttgcctgctgatagtgaggttgtcgaacaggcggtgagtgtgtataacgcc
atgcagcagaagctggcacactga

DBGET integrated database retrieval system