KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_0128Help
Entry
YPK_0128          CDS       T00665                                 

Definition
(GenBank) protein of unknown function DUF1498
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Pathway
ypy00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YPK_0128
Enzymes [BR:ypy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     YPK_0128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer
Motif
Other DBs
NCBI-ProteinID: ACA66441
UniProt: A0A0H3AYV8
Position
156082..156765
Genome map
AA seq 227 aa AA seqDB search
MKRSEVNQILKQTGHFFARHHIQLPPFARFTPQIWQQLDPKAWQELFDLKLGWDITAFGG
NHFFTQGLTLFTLRNGSVSGTPYPKCYAEKIMHVREGQVTPMHFHWRKQEDIINRGGGNL
IVELWNSDAFEQTEKSDVTVTLDGCRQTHAAGSQLRLSPGESICLVPGVYHSFWGEVGYG
EVLVGEVSMVNDDDHDNRFMKPLERFNSIIEDEPAELVLCNEYCRFV
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctccgaggtcaaccaaatccttaagcagaccggtcatttctttgcccgacac
catatccagctaccgccatttgcccgtttcacgccacaaatatggcaacagcttgaccct
aaagcctggcaagaactgtttgacctgaaactcggctgggatattaccgcattcggcggg
aaccatttttttactcagggattaacgctgttcaccttacgcaacggttcggtaagcggc
acgccttaccctaaatgctacgccgaaaaaatcatgcacgtccgcgaaggccaggtgaca
cctatgcattttcactggcgtaaacaggaagatatcatcaaccgtggcggcggcaatctt
atcgtcgagctatggaattccgacgcgtttgaacaaacggagaagagcgatgtcaccgtg
acactcgacggctgccgccaaacccatgcggcaggcagccagttacgcttatctcccggt
gaaagcatttgcctggtgcctggggtgtaccacagtttctggggcgaggtaggttacggt
gaggtgctggtcggtgaggtatcgatggtaaatgacgatgaccacgacaaccgatttatg
aaacctcttgaacgttttaattcgattattgaagacgaaccggctgaacttgtgctgtgt
aatgagtactgccgtttcgtctga

DBGET integrated database retrieval system