KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_0288Help
Entry
YPK_0288          CDS       T00665                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Pathway
ypy03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YPK_0288
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ypy03011]
    YPK_0288
Ribosome [BR:ypy03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    YPK_0288
  Bacteria
    YPK_0288
  Archaea
    YPK_0288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF733
Motif
Other DBs
NCBI-ProteinID: ACA66601
UniProt: B1JIW6
Position
322388..322720
Genome map
AA seq 110 aa AA seqDB search
METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAGLVKKVLESAIANAEH
NDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatcgctaaacatcgccacgctcgttcttctgctcagaaggttcgcttggta
gcggacctgattcgcggtaagaaagtgtcgcaagctctggaaactctaacctacaccaac
aaaaaagctgctggtttggttaagaaggtactagagtctgccattgctaacgcagaacac
aacgatggcgctgacatcgatgatctgaaagtcacgaagatcttcgtagacgaaggccct
agcatgaagcgcattatgccgcgtgcaaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system