KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_0390Help
Entry
YPK_0390          CDS       T00665                                 

Definition
(GenBank) type VI secretion protein, VC_A0111 family
  KO
K11895  type VI secretion system protein ImpH
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypy02044]
    YPK_0390
Secretion system [BR:ypy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPK_0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG Ferlin_C
Motif
Other DBs
NCBI-ProteinID: ACA66695
UniProt: A0A0H3AZE2
Position
423911..424981
Genome map
AA seq 356 aa AA seqDB search
MAGTDRSTCTDVSVVEDVSGVEARPEGQALDVSRYNFFQLVELLNQLAVAWQGAAPVATP
ANEAIRFKSTASLAFPTRDVIALDTSARGQFELEVSFLGLHGSQSPLPGYYLDSLAWEDA
QNENRLTDFMNVFNHRLLTLLHQIWRKYRYYICFDNGGDDAFSQRMFSLVGLGSEVVRNK
LQINHSKMLAYAGLLASPGRAPEVICSLVSHCFNLPDITLHSWQLRKVDIAPSQQNRLGM
RVKVRGKKYDEKSVLGVNFSIGSRVADRSGKFLLCINKLTREQFLSFLPNGANYASLVMF
VAFIMRDQFAWDLRLGLAEQQVGGMVLGTEQNSLLGWTSILGDPEQKPSVTIGVME
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggccggtacagacaggtcaacatgcactgatgtaagtgtggttgaggatgtaagtggg
gttgaggcaagacccgaagggcaggcattggatgtttcacgttataacttttttcaattg
gtcgaattgctcaaccaattggcggtagcgtggcaaggtgcggcccctgtggcgacccca
gccaatgaagccatccgttttaaatcgaccgccagtttagcattcccgaccagagatgtg
atcgcactggacacctccgcccgaggtcaatttgagctagaggtctctttccttggattg
catggcagccaatcgccgctaccaggatattacctcgattcgttagcgtgggaggatgcg
cagaatgagaaccggttgacggatttcatgaacgtattcaatcaccgcctgttaacgcta
ctgcatcagatttggcgtaaataccgttactacatctgctttgacaatggcggtgatgat
gcattttcacaacgcatgttctcgctggtggggttaggtagcgaggtcgtccgcaataaa
ttgcagatcaatcacagcaaaatgctggcttatgcagggctgctggctagccccggcaga
gcacctgaagtaatttgcagccttgtctcacattgcttcaatttgccagatatcacctta
cacagttggcagctacgcaaggtggatattgccccctcacagcagaatcgcttggggatg
agggtgaaagtccgtggcaagaaatatgatgaaaagtcagtgcttggcgttaatttctcc
atcggttcacgggttgcggatcgtagcgggaaatttttgttgtgcatcaataagctgacg
cgagaacagttcttatcctttttacccaacggggctaattacgcctcgttagtgatgttt
gtcgccttcattatgcgcgatcaattcgcgtgggatttacgtcttgggttggccgagcaa
caggtgggcgggatggttctgggaaccgagcaaaatagcctcttgggctggaccagtatc
ctcggcgatcccgaacagaaacccagcgtaacgattggtgtaatggaataa

DBGET integrated database retrieval system