KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_0395
Entry
YPK_0395          CDS       T00665                                 

Definition
(GenBank) type VI secretion ATPase, ClpV1 family
  KO
K11907  type VI secretion system protein VasG
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Pathway
ypy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPK_0395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypy02044]
    YPK_0395
Secretion system [BR:ypy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPK_0395
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 AAA_16 ClpB_D2-small AAA_22 AAA_7 NACHT TniB RsgA_GTPase Sigma54_activat AAA_24
Other DBs
NCBI-ProteinID: ACA66700
UniProt: A0A0H3AZE5
Position
429095..431698
AA seq 867 aa
MIQIDLPTLVNRLNPIARHSLEAAAAHCVSQQEAEITVSQVLLQMISTPLCDVRLILSHA
GVEEDELRESLDQRVSGYQAITQAYPSFSPLLVEWLQDSWLLASTEMEHSQLRSGVMLLT
LLLSPSRYLVPTANRLLSPINRELLRQNFANWTADSAETPRAEKGAEAGNGAEINGDSLL
ARYASNMTEQARNGELDPVLCRDTEIDLMIDILCRRRKNNPIVVGEAGVGKSALIEGLAL
RIVDNQVPEKLRNSELMTLDLGALQAGAAVKGEFEKRFKGIMAEIAQSTTPIILFIDEAH
TLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSRRFQLVKVSEP
SAQEATIIMRGLRTVYEQAHGVLIDDEALQAAAVLSDRYISGRQLPDKAIDVLDTAAARV
AINLTSAPRQVSALKNELYHQGMEIEMLEREQRLSLSRPDERLSVLQQQRIEIEQQLIAL
NTGWEKQQHLVQQIIALRAVLLAQEESATDEQVVNLTALSDELERLQQHQTLVSPHVDKS
QIAAVIAEWTGVPLNRLSQSELAVVTELPSYLGQQIKGQETAIHCLHQHLLTARADLRRP
GRPMGAFLLVGPSGVGKTETVLQIADLLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYV
GYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGELADGEGRIIDCKNIVF
FLTSNLGYQTIVDHADEPALLNERLYPELSAFFKPALLARMEVVPYLSLGMETLQIIIHG
KLNRLDTLLRQRFSADVVIEPEVIDEILLRATRAENGARMLESIIDGALLPPVSLLLLQK
VAAGTAISHIRIAVEGNVFTAQVEGAI
NT seq 2604 nt   +upstreamnt  +downstreamnt
atgattcaaattgacttgcccacactcgtaaaccgccttaatcccattgcccgccattct
ctggaagcggcggcggcgcattgcgtcagtcagcaggaagctgaaattacggtctcccaa
gtgctactgcaaatgatctccacaccattatgtgatgtcaggttaatcctgagccatgcg
ggtgttgaggaggatgaactacgggagtcgctcgatcaacgtgtttcaggctatcaagct
attacccaggcctacccgagtttttccccattactggtggaatggttacaagacagttgg
ttgctggcatcgacagagatggaacacagccaactccgtagcggcgtgatgttattgacg
ttattgctcagcccgtcgcgctatctggtccccacggccaaccggctactgtccccgatt
aaccgtgagttactgcgtcagaattttgctaactggacggcagactcagcagaaacaccg
cgagcagaaaaaggggctgaagctggcaacggcgcagaaatcaatggtgacagcttgctg
gcccgctatgccagcaatatgaccgaacaggcccgtaacggcgaattagaccctgtgctg
tgtcgggataccgaaattgatctgatgatcgatattctgtgccgccgccgcaaaaataac
ccgatagtggtgggtgaagcgggggtagggaaaagtgcgctgatcgaaggtttagccctg
cgtatcgtggataatcaggtgccagaaaaactgcgtaacagcgagttgatgacgctggat
ttaggcgcgcttcaggctggtgcggcagtgaaaggcgaatttgagaagcgtttcaagggc
atcatggcggaaattgcgcagtccacgacgccaattatcctgtttattgatgaagcacac
acgctgatcggggccggtaaccaacagggcggattagacatttccaatctgctcaaaccc
gctttagcgcgtggtgaactgaaaacgattgcggcaaccacctggagcgaatacaaaaaa
tactttgaaaaagatgctgcgctgtcgcgccgtttccagttggtcaaagtttctgaaccc
agcgcgcaagaggccacgattatcatgcgtggcctacgtacagtttatgaacaggcgcat
ggcgtcctgatcgatgatgaagcattgcaagctgcggcggtgctcagtgaccgctatatt
tcagggcggcagttgccagataaagccatcgacgtgttagataccgcagccgcacgtgtt
gccatcaatctcacctctgcaccgcgtcaggtttcggcactgaaaaacgaactctaccat
caggggatggaaatcgagatgctggagcgggagcaacgcctcagcttaagccgcccggat
gagcggttatccgttttacaacagcagcgaattgagatcgaacagcaactcattgccctg
aataccggttgggaaaagcaacaacatttggtccagcagattatcgcactgagagcggtc
ctgttggcacaagaagagagcgccacagatgagcaagtggtcaatctgacagcgctgagc
gatgagttggaacggttgcaacagcaccagacgctggtctcgccccatgtggataagagc
cagattgcggcggtgatcgcggaatggaccggtgtaccgctaaaccgcctttctcagagt
gaattggcagtggtcactgaattgccctcttatctggggcagcagatcaaaggacaagag
acggctatccattgcttgcaccaacacttgctgaccgcaagggcggatttacgtcgccca
ggtcgcccaatgggggctttcctgttggttgggcctagcggcgtgggtaaaacggaaacc
gtgctacagattgccgacctgctctatggtggccgccaatatctcaccaccatcaatatg
tccgaattccaagagaagcataccgtctcgcgcctgattggttcacctccgggctacgtc
gggtatggtgaaggcggcgtactgaccgaagctattcgtcaaaaaccttactcggtagtg
ctactggatgaagtggaaaaagcccaccccgatgtgctgaatctgttttatcaggccttc
gataagggcgagttggcggacggtgaaggccgcatcatcgattgcaaaaatatcgtattt
ttcctgacctccaatctgggataccagaccattgttgatcatgcagacgagcctgcattg
ctcaatgaacggctctaccccgagctatcggcattctttaaacctgcgctactggcccgc
atggaagtggttccttatctgtcgctgggcatggaaacgctgcaaattatcattcacggc
aaactgaaccgtctggatacgctgctgcgccaacgctttagtgctgatgtggtcattgaa
cctgaagtgatcgacgaaatcctgctacgcgcgacccgtgccgaaaatggtgcgcgtatg
ctcgagtcgattatcgacggtgcgctattaccaccggtttctctgttgttattacagaaa
gtggccgctggcaccgctatcagccacattcggatcgcggtagaggggaatgtgtttact
gcacaggttgagggagcgatatga

DBGET integrated database retrieval system