KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_0401
Entry
YPK_0401          CDS       T00665                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Pathway
ypy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPK_0401
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypy02044]
    YPK_0401
Secretion system [BR:ypy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPK_0401
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Ribosomal_L5e
Other DBs
NCBI-ProteinID: ACA66706
UniProt: A0A0H3AXA1
Position
439588..441810
AA seq 740 aa
MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEIAGGIGDAVGGTAGKRINQA
AEVAKTALDAKAKVLDGGVTPLNLAAGGAGAGLPDSVAAALTRLVKQPSGLQFTLTAAGL
PPQTFAVVDFTLSEMLSSPFVLNVGLASADPAVDFAAVLDEDATLFIWREGVLQRSITGM
VASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQASVEEIITTLLKENGINDFAFG
FRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGKNTVVYADDVGSLPKGASLP
YNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGELQNQRPDYEH
FDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRSDLNHAW
QLLGIQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGP
PGEEIYCDEYGRIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDF
LHGDPDQPIVTGRTYHANNIPPGSLPASKTQMAFRSKTHKGEGYNEMRFEDAKGGEGLFM
HAQKDMTTMVLNDRKTDVTQDHSEHIGQDQSVTVVRNQSNTIQNDRRVEVTRDQQTEVGN
DYQLVVKGEKKEFVTKIRYTEVHEDETLTVTKSIKIHAKQGDISISTPNAGITITHDGAI
ILQGKYIRLAADMIDLNPEE
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgtttgctcatgataaagctaataataataaagccgcggacaagaccggcacggtgacg
ccgacccatatcgtctcgccggaggccgccccaaccgtgagtggcgctcagatgaccgag
atagccggggggatcggggatgcggtgggcggcactgccggtaagcgcatcaatcaggcc
gccgaggtggctaaaactgccctggatgccaaggcaaaagtactggacggcggcgtcacg
ccgctgaatctggccgcgggcggggccggggcgggattgccggacagcgtggcggcggcg
cttacccgcctggtcaaacagccctcaggcctgcaatttaccctgacggcggccggttta
ccgccccagacctttgcggtggtggatttcaccctgagcgagatgctctcctcgccgttt
gtgctcaatgtcgggctggcgagtgccgatccggcggtggattttgcggcggtattggat
gaagacgccacgctgtttatctggcgagaaggggtactgcaacgcagcatcaccggcatg
gtcgccagctttgaacagggtgataccggttttcatcagacccgctacagcatggtgatc
cgcccggcgctgtggcgcaccagcctgcggcgcaatgcccgcatcttccagcaggcctcg
gtggaagagatcatcaccaccctgctgaaagagaacggcatcaacgattttgcttttggt
tttcgccacccgcacccggtgcgcgagttctgcgtgcaatatcaggagtccgattttgat
tttatccagcgcctgacggcagaagaggggattttctactacttcgagttcagcgccggg
aaaaataccgtggtgtatgccgatgatgttggctccctgccgaaaggcgcgtcactgccc
tataacccgaatgtggcggcgcaggcgcaggaactgagtatcaccaccttcacccgcagt
gcgcaggtgcgcccggcgatggtgcaactgaaagactacacctttaaaaacccgaactgg
gccgcggccttcagcgaacagtcgggagaactgcaaaaccagcgaccggactacgagcat
tttgattttccggggcgcttcaaagatgcccagcacgggcaggattttacccgctaccgg
ctggacgcactgcgcaatgacgccaatctggggcagggggcgagcaatgattttaccctc
cagccggggcagttgttcagcctgtacaaccacccacgtagtgacctgaaccacgcctgg
cagttgctcggtattcagcacagcggcaaacagatgcaggcgctggagcaggcatctggc
gatcagggcacggtgctgttcaaccacttcagttttattccgcacacccagacctggcgg
ccgacgccgttggctaaaccggcgatggacggcccgcagatcgccatggtggtggggcca
ccgggggaagagatttactgcgacgaatacggccgtatccgcctgcaatttttatgggat
cgctacgggcagagcaatgacaacagctcctgctggatccgggtaacccagccgtgggcg
ggccagggctggggcatgctggccattccgcgtattggccaggaagtggtggtggatttt
ctgcacggcgatccggatcaaccgattgtcacggggcggacctatcacgccaacaacatc
ccgccggggtcgttaccggccagtaaaacccagatggcgttccgctcaaaaacccacaaa
ggggaaggctacaacgaaatgcgcttcgaggatgccaaaggcggcgaagggctgtttatg
catgcgcagaaagatatgacgaccatggtgctgaatgatcgcaaaaccgatgtgactcag
gaccattcagagcacattgggcaagaccagtccgtgacggttgtgcgtaaccaaagtaat
acgatccaaaatgatcgccgggtggaggtgactcgcgatcaacaaaccgaagtgggcaat
gattaccagctagtggtgaaaggtgaaaagaaagagtttgtgacgaaaattcgttacacc
gaagtgcatgaagacgaaacgctcacggtgacgaaaagtattaaaatccatgccaaacaa
ggtgatatcagcatatcaaccccgaatgccggaattacgatcacccatgacggtgccatt
attctgcaagggaaatacattcgtttagcggccgatatgatcgatcttaatccagaggag
tag

DBGET integrated database retrieval system