KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_0412
Entry
YPK_0412          CDS       T00665                                 

Definition
(GenBank) putative rhs accessory genetic element
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
SSDB
Motif
Pfam: Phage_GPD
Other DBs
NCBI-ProteinID: ACA66717
UniProt: A0A0H3AYZ5
Position
452695..452916
AA seq 73 aa
MVQLKDYTFKNPNWAVAFSEQSGELQNQRPDYEHFDFPGRFKDAQHGQDFTRYRLDALRK
IIAEDQAWRYHFQ
NT seq 222 nt   +upstreamnt  +downstreamnt
atggtgcaactgaaagactacacctttaaaaacccgaactgggccgtggccttcagcgaa
cagtcgggagaactgcaaaaccagcgaccggactacgagcattttgattttccggggcgc
ttcaaagatgcccagcacgggcaggattttacccgctaccggctggacgcgctgcgcaag
atcatcgcggaagatcaggcgtggcgttaccacttccagtag

DBGET integrated database retrieval system