KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_0805Help
Entry
YPK_0805          CDS       T00665                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Pathway
ypy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPK_0805
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypy02044]
    YPK_0805
Secretion system [BR:ypy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPK_0805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Sarcoglycan_1 Adhesin_P1_N
Motif
Other DBs
NCBI-ProteinID: ACA67106
UniProt: A0A0H3B118
Position
916188..918536
Genome map
AA seq 782 aa AA seqDB search
MNTFLPTIRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIGPATML
MHDASLTLAAPMAEAFGVTVQQTQRVIQGVVTGFKRLSASKEECRYELSLQPRLALLSRS
HQNGIYQDMSVPQIVEKILRERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFIRRLLA
EVGIWFRFTVDPKLNIDVVEFYDDQRFYQQGLTLQAVPPSGMHDSGMESVWDLSSAHQVV
EKSVSTGDYNYRTATADLTAGADITRGDTTTYGEAYHYADNYLTAGSEGREPESESGAFY
ARLRHERYLNNQARFAGVANAAALAPGQELNVTGNDVPAQFGKGVIVTRITSHARRDRSY
EVHFEAIPYSEENCFRPILINKPKMAGTLPARVTSTTVNDTYGHIDKDGRYRVNLMFDRD
SWEQGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAFEDGNPDRPYIAYVLHDSVHGDH
VTISNYKRNVLRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFE
LRTDSFGVLRAEKGLFITADGQAKAQGQVLEMQPAIGLLQGAQEQMEAISADAQTATASP
ADLQAQISLLQQNLTELKQAVLLLSAPKGIALSSGEHLQMSASDNLIATAGKNADVSVAK
NFFIGVGNTLSIFVRKLGMKLIANQGPITVQAQNDLMELLARKAITITSTEDEIKITAKK
RITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRLDKAKLPTEFPALAAKTEDPIKRWL
FS
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgaatacctttctcccgactattcggtttgaccatagccaccacaaactggtggtccgc
gacagcaccgccgccgttgatgtgctgggctttgaaggccatgaaagcctgagccagccg
ttctgttacgacatccaattcaccagcgccgacaaggcgattggcccggcgaccatgctg
atgcacgacgcgtcactgacattggcggccccgatggccgaagcttttggcgtgacggtt
cagcagacccagcgggtgatccaaggggtggtcaccggatttaaacgcctgtcggcctcg
aaagaggaatgccgctacgaactgagcctgcaaccgcgcctggccttgttatcgcgcagc
catcagaacgggatatatcaggacatgtcggtgccgcagattgtggaaaaaattctgcgt
gagcgccatgacatgcgcggtcaggattttgtcttcacgctggcccgcgagtacccacgc
cgcgagcaggtgatgcagtatggcgaggatgacctgacctttatccgccgcctgctggcc
gaggtggggatctggtttcgttttaccgtcgatcccaaactcaatattgatgtggtggag
ttttacgacgaccagcgcttctatcagcaaggactgacgctacaggcggtgccgccttcg
gggatgcacgacagcgggatggaatcggtctgggacctgtccagcgcccatcaggtggtg
gaaaaatcggtcagtaccggcgattacaactaccgcaccgccactgccgacctgaccgcc
ggggccgacatcacgcgcggcgataccaccacctacggcgaagcctatcattacgccgat
aactatctgaccgcaggcagcgaagggcgcgagccggaaagtgaaagtggggccttttat
gcccgtctgcgccatgaacgttacctcaataatcaggcgcgcttcgccggggtggccaat
gcggcggcactggcaccgggtcaggaactgaacgtcaccggcaacgacgtgccagcacaa
tttggcaaaggggtgatagtcacccgcatcaccagccacgcccgccgcgaccgcagctat
gaagtgcattttgaggccatcccttactccgaagagaattgcttccgcccgatcctcatc
aacaagccaaaaatggccggcaccttgcccgcacgggtcaccagcaccacggtgaacgac
acttacggacacatcgacaaagacggccgctaccgtgtcaatctgatgtttgaccgggac
agttgggagcaaggttacgaaagcctgtgggtccgtcaggcccgcccgtatgcgggtgac
agctacggcctgcacctgccgctgctggccggcaccgaagtggcgattgcatttgaggac
ggcaacccggaccggccgtatatcgcctatgtgctgcacgactcggtgcacggcgaccac
gtcaccatcagtaattacaaacgcaacgtactgcgcactccgtcgaacaacaaactgcgc
ctggaggatgaacggggcaaagagcacatcaagctcagcaccgaatacggcggcaaaagc
cagttgaatctggggcatttggtcgataacgagaaacagcctcggggtgagggttttgag
ctgcgcaccgacagttttggtgtattacgggcagaaaaaggcctctttatcactgccgac
ggacaggccaaagcacaggggcaggtgctggagatgcaaccggctattggcctgttgcaa
ggtgctcaggaacagatggaggccatctccgcggatgcacaaaccgccaccgccagtccg
gccgacctgcaggcacaaatcagtttgttacagcaaaatctcactgaactgaaacaagct
gtcctgttactgagtgcgccaaaggggatcgcgttgagtagcggggagcatctgcaaatg
agtgccagcgataacctgattgccaccgccggtaaaaatgccgacgtcagcgtcgcgaaa
aacttctttatcggcgtaggcaataccctaagtatcttcgtcagaaagctggggatgaaa
ctaatagccaatcaggggccgataacagtccaggcgcagaatgatctaatggagttattg
gcgcgtaaagcgatcaccattaccagcaccgaggatgagataaaaatcaccgccaagaag
aggatcacgctgaatgcgggaggcagttatatcacgctggatgagaatcggatcgagtca
ggaacggcgggggaatatttgaccaaagcagggtattacgggcggttagataaggccaag
ctcccaactgaatttccagccttagccgctaaaactgaagaccccattaaacgttggcta
ttctcttaa

DBGET integrated database retrieval system