KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_0853Help
Entry
YPK_0853          CDS       T00665                                 

Definition
(GenBank) fructose-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Pathway
ypy00010  Glycolysis / Gluconeogenesis
ypy00030  Pentose phosphate pathway
ypy00051  Fructose and mannose metabolism
ypy00680  Methane metabolism
ypy01100  Metabolic pathways
ypy01110  Biosynthesis of secondary metabolites
ypy01120  Microbial metabolism in diverse environments
ypy01130  Biosynthesis of antibiotics
ypy01200  Carbon metabolism
ypy01230  Biosynthesis of amino acids
Module
ypy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ypy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPK_0853
   00030 Pentose phosphate pathway
    YPK_0853
   00051 Fructose and mannose metabolism
    YPK_0853
  09102 Energy metabolism
   00680 Methane metabolism
    YPK_0853
Enzymes [BR:ypy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     YPK_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase MR_MLE_C S-methyl_trans
Motif
Other DBs
NCBI-ProteinID: ACA67154
UniProt: A0A0H3B0G0
Position
975832..976911
Genome map
AA seq 359 aa AA seqDB search
MSKIFDFVKPGVITGDDVQKVFAVAKENNFALPAVNCVGTDSINAVLETAAKVRAPVIVQ
FSNGGAAFIAGKGVKTDAPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWL
DGLLDAGEKHFAATGKPLFSSHMIDLSEESLEENIEICSKYLTRMSKIGMTLEIELGCTG
GEEDGVDNSHMDASSLYTQPQDVDYAYEKLNAISPRFTIAASFGNVHGVYKPGNVKLTPT
ILRDSQDYVSKKHNLPHNSLNFVFHGGSGSTAEEIKEAVSYGVVKMNIDTDTQWATWEGI
LNYYKKNEGYLQGQLGNPEGADKPNKKYYDPRVWLRAAQVTMITRLELAFKELNAIDVL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaatttttgatttcgtaaaaccaggtgtcatcacaggtgatgacgtgcagaaa
gttttcgcagtagcaaaagaaaataactttgctctgccagcagttaactgtgtaggcact
gactctatcaacgcagtgctggaaaccgcagccaaagtgcgcgcacctgttatcgttcag
ttctccaacggcggcgctgcgtttatcgcaggtaaaggcgtgaagactgatgctccacaa
ggtgctgcaatcttgggtgctatttctggtgcacaccatgtacatcagatggctgaacat
tacggtgttccggttattctgcacaccgaccattgcgcgaagaaattactgccatggtta
gatggtttactggatgcgggtgagaaacactttgcggcgaccggcaagccactgttctct
tctcacatgatcgacctgtctgaagagtctctggaagagaacattgaaatttgcagcaag
tacctgactcgtatgtcaaaaatcggtatgacactggaaattgaactgggttgtactggt
ggtgaagaagatggtgtggataacagccacatggacgcttcttctctgtacactcagcca
caagatgttgattacgcatacgaaaaactgaacgctatcagcccacgtttcaccatcgct
gcctcttttggtaacgtacacggtgtttacaagccaggtaacgttaaactgaccccaact
attctgcgcgattctcaggattatgtttccaagaaacacaatctgccgcataacagcctg
aacttcgtgttccatggcgggtctggttctactgctgaagagatcaaagaagcagtaagc
tacggcgtagttaaaatgaatatcgacaccgatacccagtgggcaacgtgggaaggtatt
ctgaactattacaaaaagaacgaaggctatctgcaaggccaactgggtaacccagaaggt
gctgacaagccgaacaagaaatactacgatccacgcgtatggttgcgtgctgcccaggtg
acaatgattactcgtctggaactggcattcaaagaactgaacgccatcgacgtactgtaa

DBGET integrated database retrieval system