KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_1471
Entry
YPK_1471          CDS       T00665                                 

Definition
(GenBank) ImpA domain protein
  KO
K11902  type VI secretion system protein ImpA
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypy02044]
    YPK_1471
Secretion system [BR:ypy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPK_1471
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: ACA67764
UniProt: A0A0H3B1T5
Position
complement(1624645..1625838)
AA seq 397 aa
MSEQSIAERAGYYQSMMQPIPGDFPCGKNLEYDPAFIMLQTKLQPKQAAEYGNFVEVAEP
NNWTDIERKCLELLNNSRDIRLFIILMRCRMRQVGVGALQEGLEAILWCLDTWPDQLHPQ
LFDEGEFEPLMRGNAFAELEDIDGFIADFRNQQLPKAAGVQLSIKEFEKAHSVPREEGAL
DEGTLEAVKQEWQNRSDHTILSLQHAYALLQGLATRLNNSLGEDTPDFVRMTSVLRHFDA
AITPIAPIVVPEPIETPDVVELYPVATAMLASTEMPVTAEVQTVAETQMAIPIEAPQQRQ
AVVTPSPPLQPLQLQSAQLQPVPIQSPPVPVQQQGIQNRADALARLIEVREWFTAMEPSS
PVIALLAFSEKTIGKSFGELLQFIPQELISKLNEGQE
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgagtgaacagagtatcgctgaacgtgccggttattatcaaagcatgatgcagcccatt
ccaggtgactttccttgtggcaaaaatctggaatatgacccggcatttattatgctacag
acaaaattgcagcctaagcaggccgctgaatacggcaattttgttgaggtcgctgaaccc
aataactggacagatatcgagcgtaaatgccttgaactcctgaataattctcgggatatt
cggctgtttattattctgatgcgctgccggatgcgtcaggtcggtgtgggcgcgttgcaa
gaagggctggaagccatactttggtgcctcgacacttggcctgatcagctacatcctcag
ctgtttgatgaaggggaatttgaacctttaatgcgcggtaatgcttttgctgaactggaa
gacattgatggttttatcgccgacttccgtaatcagcagttacccaaagccgctggcgtg
caactttccatcaaagagtttgaaaaggcacactccgttcctcgagaagaaggggcattg
gacgaagggactctggaagccgtcaagcaagagtggcagaaccgatcagatcacaccatt
ctttcactccagcacgcttatgccttgttgcaaggattagccacgcgcctcaacaactcc
ctcggtgaagacacacctgattttgtcagaatgacctcggtgttacgccactttgatgcc
gcgataaccccgatagcgcctatcgtggtgccagaacctattgagaccccagacgttgtc
gagctctatccggtcgccacagcgatgctagcaagcacagaaatgccagtgaccgccgag
gtacagacggttgcagagacacaaatggccatacccattgaggctccccaacagcgtcaa
gcggtggtaaccccatccccgccgttgcagccgttacagttgcaatcggcacagttgcaa
cctgtaccgatacagtcgccgccggtgcctgtccaacagcaggggatccaaaacagggct
gatgcgttagcccggcttatagaggtgcgagagtggtttaccgccatggaaccgagtagc
ccggtcattgccttactggctttttcagaaaaaactatcggcaaaagcttcggcgaattg
ctgcagttcattcctcaggaactgatttcgaaactcaatgaaggacaggagtaa

DBGET integrated database retrieval system