KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_1472
Entry
YPK_1472          CDS       T00665                                 
Name
(GenBank) type VI secretion protein, VC_A0111 family
  KO
K11895  type VI secretion system protein ImpH
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypy02044]
    YPK_1472
Secretion system [BR:ypy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPK_1472
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ACA67765
UniProt: A0A0H3B0A3
Position
complement(1625937..1626962)
AA seq 341 aa
MLPDESVHQEKHANLDAWYQESQPWNAGFISMMRANAARTPTLPAPGKAPLPEQEAFRIG
QSAHMTFSPREISHAVMKDGKMDLQLFGLGIWGPNGAMPLQMTELAYTRAELHDHTMTDF
VDLFHHRALSQLYRAWFVSQDTASLDRQSDEKFSFYVGSLAGLDPQELNDTELPVHARLA
SSAHLIREARNPEGLVGALQYYFDVPVRMVEYAEQWIFLEESDQTQLGDGAGAMLLGDGA
ILGNTVLDRQHKFQLILGPLSLQQYLRFSLWGQDLPVLREWVRNFVGFEYAWEVQLLLSA
DEVPMATLDGGHQLGYTSWLARSDTTLDVGGMSFEPEMHHD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgttgcccgatgaatccgttcaccaggaaaaacatgccaatctggacgcctggtatcag
gagtctcagccatggaacgccggttttatcagcatgatgcgggcgaatgccgcccgcacc
cctaccctgccagcgccaggaaaagcgcccttgcctgaacaggaagccttccgcatcggg
caaagtgcgcacatgacgttctctccgcgtgagatatctcatgcggttatgaaagacggg
aaaatggatctgcaactttttggcttagggatttgggggccaaatggtgcgatgccgctt
cagatgaccgaactggcctatacccgtgccgagttgcatgatcatacgatgacggacttc
gtcgacctttttcatcaccgcgcattatcacagctttatcgggcgtggtttgtctctcag
gataccgcctcgctagaccggcagagtgatgaaaaattctccttctatgtcggtagtctg
gccgggctggatcctcaagaacttaatgacaccgaactcccggttcatgcccggttagcc
tcctctgcccatttgattcgtgaagcgcgcaaccccgaagggctcgtgggcgcattgcag
tattactttgacgtccccgtgcggatggtggagtacgccgagcagtggatctttctggaa
gaaagcgaccagacacaattgggtgatggtgccggcgcgatgctcttgggcgacggtgct
attttgggcaataccgttttggatcggcagcataaatttcaactgatcctcggccccctc
agcctgcaacagtacctgcgctttagcctctggggacaagacttaccagtattgcgagag
tgggtacgtaactttgttgggttcgaatacgcctgggaagtccagttgttgttaagcgcc
gatgaggttcccatggcaacactcgatggcggacatcaattgggatacacctcttggtta
gcccgcagtgataccacccttgatgtcggtgggatgagttttgagcctgaaatgcatcac
gattaa

DBGET integrated database retrieval system