KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_1485
Entry
YPK_1485          CDS       T00665                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Pathway
ypy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPK_1485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypy02044]
    YPK_1485
Secretion system [BR:ypy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPK_1485
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C Colicin_V
Other DBs
NCBI-ProteinID: ACA67778
UniProt: A0A0H3B3I5
Position
1643872..1647699
AA seq 1275 aa
MSYLNRLFSGWAMKRILLVGCFILLAAAIWFLGPFLGFGEARPLESYEARIICILLALLL
ILGFWYGAPRFVIAAVVACAAVWVIGPFILVGDDHPLTDGIRRGIIIAIIAFITLIYGTW
CLVKALAKNPALLDNFIKHKKAAKPEAEAELSEVNAMIRNGMNYVRRIHSGIPAWRRFFI
SSRWRTELPWFMVVGMKGAGKTALILSSGQDFPLPEQLNRIGKENPPTQHCECLFSNDAL
FLDTSGKYIDDSKDNQTEWSGILKALKKYRPVKAINGVIVAISASDILGKSKADLLNVSA
TLRTRLDEVRAVLGVRFPVYVTITKLDQLSGFDEYFRNLTAEDREQIWGVTFPYNEAKEQ
SDMPLQQRISHELALLEDRISNNMHVRQQEEYAVADRKGMYALPQDFRMLSQRVTEVLQN
VFFASRFDETKFHTTLRGIYFVSSCQPADVELLNNNTLIQKWRNVINHKKPLSPADLSQK
SDNEDRFISDVAYGKQYFLKQLFSDVITKDADLVSYNLKVQSKYRFQNLLGHAACIGLAV
WLVWAFLVSFQHNEGYLQATGAKLSQLESTVMSYAKTSNEQILPALLNATQQLPEYGTLD
VANPELDWRYGLYTGSAISQGANTLYQFFLQKYLFPMVEHQSEVALRKTMHSGQSEEVYA
ALKLYLMLTGEGKFDRQYMIEHVTQDWQKSGKIEPYEEKSIFVGHLNTLFTLKDWRQYGQ
PADSELIKQARAILAEKTVTARLWGRIQSRLLADAPANMTLRKMVGEHATQVFTLSDDEL
LHEGIPGLYTYAGYHEVVKKKLTPLLMLLQEEDRWVMAQSLSSSLDPLTLRQDVLVMYLQ
GYAAYWKRFLSSVRLISVDADSAEYAQGLSLDIALLRTLVSENSPLLNLARQAVKETTLA
EKEKAITDEINIRTQGQLLSQAKKLQETIAFRENKLIKEWVDNRFESLRVFVNGEQSADA
PGGNNLSVLQGTQMSRIIGTLNDQYTRFVVYNSAFEYGDIPPLSQDGERIAVESQTWPDP
FRNIIAPLLTGSSQKFENKVITHTSKAIDMGVGEICRNTLQGRYPFAESEQIVSLNDFER
FFGTDGTVDSYFKKNLESKVDTSSIPWRYKGSVSSEGLAFFEQAAMIRNVLFNTNDGKKM
ALDFSVSVRYLAPTITQLIMNFDGNTVRYSHGPVTPAFFKWPGLRQGTIVSLTAQRQKAS
AMPDILFRGPWALLQWADQADEIRDEANGKQTLTYLMGKDRVELEVSGLTHGGETISDLL
RDFKCPSVNDMNGIW
NT seq 3828 nt   +upstreamnt  +downstreamnt
atgtcttatttgaatcgattgttttctggctgggccatgaaacgcatattgctggtcggc
tgctttatattgctggctgcggcgatatggtttctggggcctttcctcggctttggtgag
gcgcggcctctcgaaagttatgaagccagaattatttgcatcctgctggcactgctgctg
atcttaggtttttggtacggcgcaccgcgctttgtcattgccgccgtcgttgcctgtgct
gcggtatgggtgattggcccattcatattagttggtgatgatcatcctctgactgatggg
atccgtcgcggcatcattatcgccatcattgcatttattacacttatttatggtacctgg
tgcttagtcaaagcattggcgaaaaatccagcgttactggataacttcattaagcacaag
aaagcggccaagcctgaagcggaggctgaactttctgaagttaatgcgatgatccgcaat
ggcatgaactatgtgcgccgtattcacagtggtattccggcctggcgacgtttctttatc
tccagccgttggcgcacagaactgccttggttcatggttgtcggtatgaaaggtgcaggg
aaaaccgcccttatcctctcttcaggacaggactttcctttacctgagcagctgaatcgt
attggcaaagaaaacccacccactcaacattgtgaatgtttgttctctaatgacgccctg
tttttagacacttcagggaaatacattgatgacagcaaagataatcagactgagtggagc
gggatattaaaggcactcaaaaaatatcgtccggttaaggcaattaatggtgtcattgtc
gcgatttcggcatccgatatcttgggtaaaagtaaagctgatttactgaatgtgtcggcg
acgctacgcacgcgtttggatgaggtacgtgcggtcttgggcgtccgtttcccggtgtat
gtcacgattacaaaactggatcaattatcgggttttgatgaatatttccgtaatttaacg
gctgaagatcgcgagcaaatttggggggtgactttcccttataacgaggcgaaagagcaa
tccgatatgccacttcagcaacgtatcagccatgagctggcactgcttgaggatcgtatc
agcaataatatgcacgtccgccagcaggaagagtatgccgtggcggacagaaaaggcatg
tatgcactcccccaggatttcaggatgctctcccagagggtaacggaagttttacagaat
gttttcttcgcctcacgctttgacgaaacaaaatttcacacgaccctgagagggatctat
tttgtcagcagttgtcagcctgcggatgttgaactgttaaataacaacacgctgattcaa
aagtggcgtaacgttattaatcataaaaaaccgttatcgccagccgatttatcacaaaaa
agtgataatgaagatcggtttatcagcgatgtggcttacgggaaacaatatttcctcaag
cagttgtttagcgatgtgattaccaaagatgccgacttagtcagctataacctgaaagta
caatccaaataccgttttcagaatctattgggacacgcggcttgtattgggttggcagtt
tggttggtttgggccttcttggtcagcttccagcataacgaggggtatttacaggcgacc
ggtgccaagctgagtcagttagaaagcacggtgatgagttatgccaaaacgtccaatgag
cagatcttacctgcgttattgaacgcgacacagcagttacccgagtacggtacgctggat
gtggctaaccctgagcttgactggcgttatggcttatataccggtagcgcaatctcacaa
ggtgcgaacacgctctatcagtttttcttgcaaaaatatctcttcccaatggttgagcat
cagagtgaggttgcattaagaaaaacgatgcactcaggtcagagcgaagaggtttatgcc
gcgttgaagctttatttgatgctgacgggtgaaggtaaatttgatcgtcaatatatgatt
gagcacgtgacccaagattggcagaaaagtggaaaaattgagccttacgaagagaagagt
attttcgtcggtcatttgaacacgctgtttaccctgaaagactggcggcagtacgggcaa
ccggcagacagtgaactgattaagcaggctcgggcaatattggcggaaaaaacagtgacc
gccagactttgggggcgtattcaatcccgcttattggccgatgcccctgccaatatgacg
ttacgtaaaatggtgggtgagcacgcgacacaggtattcaccctgtcagatgatgaacta
ctgcatgaagggatcccagggctttatacctacgcgggttaccatgaggtggttaaaaaa
aaactgacacctttgctgatgttacttcaagaagaggataggtgggtgatggcgcaatcg
ctgtcatcttctcttgacccattgacgttaagacaagatgttctggtgatgtatttacaa
gggtatgccgcttattggaaacgctttctctccagtgttcgtctgatttctgtcgatgcg
gacagtgcagagtatgctcaagggctgtctctggatattgctttgttaaggacgttagtt
tcagaaaattcaccgctactcaatttagccaggcaggcggtaaaagaaacgacactcgcc
gaaaaagaaaaagccattactgatgagataaacatcagaacgcaagggcaattactcagc
caggctaaaaaattacaagaaacgatcgcgtttcgtgaaaataaactgattaaagagtgg
gttgataatcgttttgaatccctgagagtctttgttaatggggaacagagtgctgatgcc
ccggggggcaataatctttctgttcttcagggaacgcagatgagccgaataatcgggaca
ttaaacgatcaatatacgcgttttgttgtttataacagtgcctttgaatatggcgatatc
cctccgttatcccaggatggggaacgtattgcggtggaatcacaaacgtggccggatccg
tttagaaatattattgcaccgttattaacgggctcatctcagaaatttgaaaataaagtg
attactcacacgtccaaagcgattgatatgggggtgggggaaatttgccggaatacgctg
caagggcgttatccatttgctgaaagtgagcaaattgttagtttgaatgattttgagcgt
ttcttcggtactgacggtacggtggacagttatttcaagaaaaacttggagagtaaagtc
gacacctcctcaataccttggcgttataagggcagcgtaagtagtgaaggtttggcgttc
tttgaacaggcggcaatgatcagaaacgtgctatttaataccaatgacggtaaaaaaatg
gcattagatttttccgtatcagtgcgttatttagcacccactatcacccaacttattatg
aattttgatggtaatactgtgcgttattcccatggtcccgtaacgcctgccttctttaaa
tggccgggtttacgtcaaggcaccattgtcagtttaacggcccaacgccagaaggcatcc
gcgatgcccgatattctttttcgcggaccttgggcactcttgcagtgggctgatcaggcc
gatgaaattcgcgatgaagcgaatggcaaacagacgctgacttatctcatggggaaagat
cgtgtcgagcttgaagtctcaggtttaacgcatggtggtgaaaccattagcgatctgctg
agagatttcaaatgccccagtgtcaatgacatgaatggtatttggtaa

DBGET integrated database retrieval system