KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_1490
Entry
YPK_1490          CDS       T00665                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11897  type VI secretion system protein ImpF
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypy02044]
    YPK_1490
Secretion system [BR:ypy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPK_1490
SSDB
Motif
Pfam: GPW_gp25 Fur_reg_FbpB
Other DBs
NCBI-ProteinID: ACA67783
UniProt: A0A0H3B3J0
Position
1652892..1653371
AA seq 159 aa
MEKKKQFLPALLERLLDDEPKKHIEPHDKFFYDSRTMRKLVQRNISEILNNANIEDRLDP
QRHKWVATSVLNYGISPLVGLYAVPHNWATIERIIREAIIRFEPRIMAESLVVSQQLQAR
NGIIQFEIRGLIKWNPHPIDLCIEGAYDVETDNAELRAR
NT seq 480 nt   +upstreamnt  +downstreamnt
atggaaaagaaaaaacagtttttaccggcgttgttagagcgtttactcgatgatgagcct
aaaaagcatattgagcctcacgataaattcttttatgactcacggacgatgcggaaattg
gtacaacgtaatatttcagagatattaaataatgccaatattgaagaccggttggatccg
cagcgtcataaatgggtagcgacgtcggtcttaaactatggtatttcacccttggttggg
ctttatgccgtgccgcataattgggcgactattgaacgaattatcagagaggccattatc
cgttttgaaccacggataatggcggaatctctcgttgtcagccagcaactccaggccagg
aatggcattatacagtttgagattagggggttaatcaaatggaacccgcaccctatcgat
ctttgtattgaaggtgcctatgacgttgagacggataacgcagagctacgcgcccgttga

DBGET integrated database retrieval system