KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_1551Help
Entry
YPK_1551          CDS       T00665                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Pathway
ypy00430  Taurine and hypotaurine metabolism
ypy00620  Pyruvate metabolism
ypy00640  Propanoate metabolism
ypy00680  Methane metabolism
ypy01100  Metabolic pathways
ypy01120  Microbial metabolism in diverse environments
ypy01200  Carbon metabolism
Module
ypy_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    YPK_1551
   00640 Propanoate metabolism
    YPK_1551
  09102 Energy metabolism
   00680 Methane metabolism
    YPK_1551
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    YPK_1551
Enzymes [BR:ypy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     YPK_1551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ACA67844
UniProt: B1JGK4
Position
complement(1713682..1714884)
Genome map
AA seq 400 aa AA seqDB search
MSSKLVLVLNCGSSSLKFAIIDATNGEEHISGLAECFHLPEARIKWKVDGGKQEAALGAG
AAHSEALNFIVNTILAQKPALSAQLTAIGHRIVHGGEKFTSSVIVTDDVIQGIKDSIPFA
PLHNPAHLIGIAEALKSFPNLADKNVAVFDTAFHQTMPEESYLYALPYSLYKDHGIRRYG
AHGTSHFYVSQEAAKILNKPLEELNVITCHLGNGGSVTAVRNGKCVDTSMGLTPLEGLVM
GTRSGDLDPAIIFHLHDAMGMSVDQINTLLTKESGLLGLTEVTSDCRYVEDNYATKADAK
RAMDVFCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAMVRELTLDKLGLLGFEIDHER
NMAARFGKSGTITKDSSRLALVIPTNEELVIAQDAARLTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtaagctagtactggttcttaactgcggtagctcctccctgaaatttgcaatc
atcgatgcgaccaacggtgaagagcatatttctggtttagccgaatgtttccatctgcca
gaagcccgtatcaaatggaaagttgacggcggtaagcaggaagcagcattgggtgctggt
gcagcacacagcgaagcactgaattttattgttaatactattttggcacaaaaaccagcg
ctttctgctcagttgacggccatcggtcaccgtatcgttcacggcggcgagaaattcact
tcgtcagttatcgttaccgacgatgttattcagggtatcaaagattctatcccgtttgca
ccactacacaaccctgcccacttgatcggtattgctgaagccttgaaatccttccctaat
ctggcggataaaaatgtggccgtctttgacaccgcgttccatcagaccatgccggaagag
tcttatctctatgctctgccgtacagcctgtataaagatcacggtatccgccgctatggc
gcacacggtaccagccacttctatgttagccaagaagccgccaagatcttgaacaagccg
ttggaagaactgaacgtgattacctgccatttgggcaacggtggttcagtaaccgcagtg
cgtaacggtaaatgtgtcgatacgtcaatggggctaacgccactggaaggtctggtgatg
gggacccgcagtggtgatctcgatcccgctattatcttccatctgcatgatgctatgggc
atgagcgttgatcaaatcaacacgttgctgaccaaagagtcaggcctgttggggctgact
gaagtcaccagcgactgccgttatgttgaagataactacgccaccaaagctgacgcgaaa
cgtgcgatggatgtgttctgtcaccgtttggcaaaatatatcggttcctataccgcgctg
atggatggtcgtctggatgcggtcgtcttcaccggtggtattggtgaaaatgctgccatg
gtccgtgaactgacgctggacaaattgggcctgctgggctttgagattgaccacgaacgt
aacatggcagcacgctttggcaagtcaggtaccatcaccaaagatagcagccgtctggct
ctggttatcccaaccaacgaagagttggttatcgcgcaagacgcagcccgtctgactgcg
taa

DBGET integrated database retrieval system