KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_2583Help
Entry
YPK_2583          CDS       T00665                                 

Definition
(GenBank) ImpA domain protein
  KO
K11911  type VI secretion system protein VasL
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypy02044]
    YPK_2583
Secretion system [BR:ypy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPK_2583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VasL ImpA_N EF-hand_7
Motif
Other DBs
NCBI-ProteinID: ACA68860
UniProt: A0A0H3B3D9
Position
complement(2838599..2839966)
Genome map
AA seq 455 aa AA seqDB search
MAGNTERLLKTGGDPRALADFTALRGELNKLAHPARPDVDWARVEQLCLALFRQNGVELQ
TAVDFTLARTHTAGLAGLCEGLELLAGLVCHQWSGLWPPQTHVRVALLAWLSDRLQQVWR
TMTLCYGDLAQVYRAERALEQLCAQLQTLELKHLCKLDGVRLMLHNAAQRLESTEAVSGL
AKPRGASEPPESLRFASVPVSEPLVYIISEPAPPPVQVVLPASPPRWKAGHGFAAGLSLM
AVLMAGSFVIWQSVSSDPVRETLLATASPLPIPLSANSIAELKKQASDVEWARLAEPVLQ
ASATQLDQLAQLPPLWAQARGDALLSQAQQLWPASQEVKRLSTLWQQQREAGAAPLVELK
HYALAQDRLRQLAERLNSLDEKKRGYMTVSELKSAVFAIQQPLAQAVPLEELLRQYQEQL
ESGQTPSSALRQQIDSRFSQLLNRYALLVVPPGVQ
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtaataccgagcgtctgctgaaaaccggtggcgacccgcgcgcactggcggat
ttcaccgcactgcggggtgaattaaataaactggcccacccggcccgcccggatgttgac
tgggcgcgggttgagcaactgtgtctggcgctatttcgccagaacggcgttgagttacag
accgccgttgattttaccctggcacgaacgcacaccgccgggttggcgggtttatgtgaa
gggctggaactgttggcggggttggtctgccatcaatggagtgggttatggccaccgcaa
acgcatgtccgggtggcgttactggcctggctgagtgaccggctgcaacaagtgtggcgc
accatgacgttatgctacggtgacctggcgcaggtgtaccgggcagagcgggcgctggaa
cagttgtgcgcacagttgcaaacgctggagctcaaacatttgtgcaagctggacggggtt
cgtttgatgctgcataacgcggcgcagcggttggaaagtaccgaggccgtgtctggcctt
gcgaaaccacggggtgcctctgaaccgcccgagtcgctgcgatttgcctctgtcccggtc
agtgaaccactggtgtatattatcagcgaaccggccccgccacctgttcaggtggtttta
cctgcctcacctccgcgctggaaggcgggccacggttttgccgcggggttatcgttgatg
gcggtgctgatggccggcagtttcgttatctggcagtcggtatcatcggatcccgtgagg
gaaacattgctggccactgccagtcctttgccgataccgctgagtgctaactcaatagct
gaactgaaaaaacaggcttcagatgttgagtgggcacgtctggcggaaccggtgttgcaa
gccagtgcgacgcagttagatcaactggcacagttaccgccgttatgggcgcaggctcgg
ggggatgccttgctatctcaggcgcaacaactgtggcccgcgagtcaagaggtcaaacgg
ttgagcactttgtggcagcaacagcgagaagccggtgctgcgcccttggtagagttgaaa
cactatgcattggcgcaagaccgtttgcggcaactggcagaacgactgaatagtctggat
gagaaaaaacgcggatatatgacggtctccgaactgaaatctgccgtctttgctatccaa
cagccgctggcacaggccgtgccactggaagaactgctgcggcaatatcaggaacaatta
gaatcagggcaaactccatcctcagcactgcgtcaacagattgacagccggtttagtcaa
ctgctgaaccgctatgcgttgctggtcgtacctcctggcgttcagtaa

DBGET integrated database retrieval system