KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_2649
Entry
YPK_2649          CDS       T00665                                 

Name
(GenBank) porin Gram-negative type
  KO
K09476  outer membrane pore protein F
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Pathway
ypy01501  beta-Lactam resistance
ypy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YPK_2649
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    YPK_2649
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypy02000]
    YPK_2649
   01504 Antimicrobial resistance genes [BR:ypy01504]
    YPK_2649
Transporters [BR:ypy02000]
 Other transporters
  Pores ion channels [TC:1]
   YPK_2649
Antimicrobial resistance genes [BR:ypy01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, repression of porin OmpF [MD:M00746]
    YPK_2649
SSDB
Motif
Pfam: Porin_1 Porin_4 OMP_b-brl
Other DBs
NCBI-ProteinID: ACA68926
UniProt: A0A0H3B637
Position
2911078..2912160
AA seq 360 aa
MMKRNILAVVIPALLAAGAANAAEIYNKDGNKLDLYGKVDARHSFSDNNKQDGDKSYVRF
GFKGETQITDQLTGYGQWEYNIQANNAEESGAQEGNATRLGFAGLKFAEFGSFDYGRNYG
VIYDVNAWTDMLPVFGGDSISNSDNFMTGRSTGLATYRNNNFFGLVDGLNFALQYQGKND
RSEVKEANGDGFGIGSTYDIGNGINFGAGFSSSNRTLDQKYGSTAEGDKAQAWNVGAKYD
ANNVYLAVMYAETQNLTPYGSFSDTIANKTRDIEITAQYQFDFGLRPSLGYVQSKGKDLN
DVDANHDLLKYVSVGTYYYFNKNMSTYVDYKINLLDEDEFTIANGLNTDNVVAVGLVYQF
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgatgaagcgcaatattcttgcagtagtaatcccagctctgttagccgctggtgcagct
aatgcagcagaaatctataacaaagatggcaacaaacttgacctgtacggtaaagttgac
gcacgtcactctttctccgataacaacaaacaagatggcgacaagtcttacgttcgtttc
ggcttcaaaggtgaaacccaaattactgaccaactgaccggttacggccagtgggaatac
aacattcaagcaaacaacgctgaagaatcaggcgctcaagaaggcaacgcaacccgtctg
ggctttgctggtctgaaatttgctgaattcggttcattcgactacggccgtaactacggc
gtaatctatgacgttaacgcatggactgacatgctgccagtgttcggtggtgattcaatc
tccaactctgacaacttcatgactggccgttctactggcctggcaacttatcgtaacaac
aatttcttcggtctggttgacggcctgaactttgccctgcaataccaaggcaaaaatgac
cgttctgaagtcaaagaagctaacggtgacggcttcggtatcggttctacttatgatatc
ggcaatggcattaacttcggtgctggtttctcttcttcaaaccgtactcttgatcaaaaa
tatggttctaccgctgaaggcgacaaagctcaggcatggaacgttggcgctaaatacgac
gcaaacaacgtatacctggctgtaatgtatgctgaaactcagaacctgactccatacggt
agcttctctgatactatcgctaacaagactcgcgatatcgagatcactgcacaatatcag
ttcgacttcggtctgcgcccatcactgggttatgttcagtccaaaggtaaggacctgaac
gatgttgatgccaaccatgatctgctgaaatatgtttctgttggtacttactactacttc
aacaaaaacatgtctacctatgttgattacaaaatcaacttgctggacgaagatgagttc
acaatcgcaaacggtctgaacaccgacaacgttgttgctgttggcttggtttaccagttc
taa

DBGET integrated database retrieval system