KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_3550Help
Entry
YPK_3550          CDS       T00665                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Pathway
ypy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPK_3550
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypy02044]
    YPK_3550
Secretion system [BR:ypy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPK_3550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related IcmF_C ImcF-related_N AAA_16 AAA Rad17
Motif
Other DBs
NCBI-ProteinID: ACA69817
UniProt: A0A0H3B7Z0
Position
complement(3905709..3909203)
Genome map
AA seq 1164 aa AA seqDB search
MIRRMLILIIALVLCYIVWWIGPLIAIGPYFPLGGVWVRKIIIALILFWALWPFVAIFFS
WIFRYARAPLPKRKKKTVQLDRVSARFHDAMLTLQHADLSSQKTRWQRWRQRRKRQYIDA
KPWFLVMGPPGCGKTSIVYESSEKFLLSEQYGLAQTTDIGPTQDCNWWLTDRAVYIDTAG
EWILLHGQSEEAGTARQKLFSMIRKYRRYPGVDGIVLCLDVSVLLNSSVTERKSLADTLR
LRILEVASTFQADIAVYLFLNNIDKLPGGETFLSLMNDELLAGGLGISMTHNEKGQNNFV
ADEERYRELLTRVSRYVLEILHDSPNMEMRHQLLLFTESLGALQKPLFGLFEQIFPATPI
GYTGCLRQFWFGSTQNLTSWEALYYPSSTSTFESRPAGQMYFPALSQAITERGVLHATGP
MPLRNRLLNIGKYVFVVLVLCILLLMLSARYFWEYDYIGYATARFEETRRIVRDIPITNQ
VNDNLVAAYEQLGYINTHYLESSPPLLTPYFEHRLLNQAMLQTYHRHLNKVFWPAVQNYV
TNELKKDTQSPDGDNYDTLKVYLMLGQPDHRSQEALVQWFMSRWESFAPQGYGQNDRKLF
SYHLSELFSDTASAAPKVKLNDELIRESRIKAMKTPIHIRVINRIHDAPLPARIEDLSLA
DAAGPSVTLMLRRKSPSTVTDLAIPAFYTRASYHDVVNPQLQEASEAMINEEAWVLSDGK
ASVSQVSLLAAAQKLSDEARKYYLMEYANQWDAFFNDIRVRPINGLDDAALLARQLSDPS
SPLANLVRFSTREITLTTDNNGKGAMSSGWFNIQRNKLTTARRNIIDEMSGERSRFRLTP
EKAVEDRFELLRRLGYALQSASTSNSDPLGRTFEQIYNQLITLSTSLRAGQILPQNNDFS
RLQIDMARQPEPVRSIMMDLLAVGQTQSLQQSKANLSKGVSSIASDLCSNAVSGRYPFNR
LASEEIGIGDFNRMFGRSGAMQSFFDQNLAPYVDTNGNRWKVKPDSNGVVTPKTLRSFEN
SAQIRDTFFDASGKMAMSMIIRPISLTPSILEAVLDVDGQIINYSHGSNQPVKVDWPGPK
GGVYIRLTFKTQDGNVETVSFNGPWAIFRMYDVSNPRPLGVNSRELMMVMDNVSGVFKIE
LSSTMKDYPLWSKALAQFSCPKNL
NT seq 3495 nt NT seq  +upstreamnt  +downstreamnt
atgatacgcagaatgttgattttaatcattgccctagtgctttgttatattgtgtggtgg
atagggccgctgatcgccattggcccctatttccctctggggggggtatgggttcgtaag
atcattattgctctgattttattttgggcactgtggccatttgttgcaattttcttcagt
tggatttttcgttatgcccgtgcgccacttcccaagcgcaagaaaaaaacggttcagctt
gatcgcgtttctgcacgttttcatgatgcgatgctcaccctgcaacatgcggatctttca
agccagaaaacacgctggcagcgctggcgtcaacggcgtaagcgccagtatatcgatgct
aaaccgtggtttctggtcatggggccacccggatgcggtaaaacgtcgatagtttatgag
agtagcgagaagttcctactctcagaacagtatggtttagcgcagaccacggatattgga
ccgacgcaggactgtaattggtggctgacggatcgtgctgtttacatcgatacggcaggg
gaatggatcctgctgcatggtcagagcgaagaagcgggcacggctcggcaaaaattgttc
tctatgatccgcaaatatcgccgttatccgggggttgatgggattgttctttgccttgac
gtcagcgtgcttttgaactcttcggtgacggaacgtaagtcactggctgatacgttgcgt
ctgcggatcctggaagttgcctcgacatttcaggccgatattgcggtgtacttgttcctc
aacaatatcgataagttacctggcggcgaaaccttcctctcgctaatgaacgacgaactt
ctggccggagggcttgggattagcatgacccataatgaaaagggtcagaacaatttcgtt
gccgatgaagaacgttaccgtgaactcctgacacgtgttagccgttatgtgttggaaata
ctgcacgattcgcccaatatggagatgcgccaccaattgctgctgtttacagaaagcctg
ggagcgctacaaaaacccctgtttggcttattcgaacaaatatttccggcgacaccgatt
ggctataccggttgtttgcggcagttctggtttggcagtacccaaaatctgacctcatgg
gaggcgctgtattatccgtcatcgaccagcacctttgaaagccggcctgctgggcagatg
tatttccctgcactgagtcaagcgatcaccgaaaggggggtattacacgccaccggccca
atgcctctgcgaaatcgcctgttaaacatcggtaagtatgtgttcgtggtccttgtgctc
tgcatcttattgttgatgctgagcgcccgctatttttgggaatatgactatattggctat
gcgacagctcggtttgaggaaacccgtcggattgtgcgtgacatcccaatcacgaatcag
gtcaacgataatctggtcgcagcttacgaacagttggggtatatcaacacccattatctg
gaaagttcaccgccactgctgacaccgtacttcgagcaccgtttactgaatcaggcgatg
ttgcaaacctaccatcgtcacctgaataaagtgttctggcctgcggtacaaaactacgtc
accaacgagctgaaaaaggacactcaatctcctgacggtgacaactatgacacgctgaaa
gtttacctgatgctcggacaacctgatcaccgctctcaggaggcattggtgcaatggttt
atgtcgcgctgggaaagttttgcgcctcagggatatgggcaaaacgaccgcaaactcttc
agttatcatttgagtgaactgttttctgacaccgcctcagctgccccgaaagttaagctg
aatgatgagctgatccgtgaatcacgcattaaagcgatgaaaacaccgatacacatccgg
gtgattaatcgtattcatgacgccccactgcccgcgaggattgaggatcttagtctggct
gatgccgccggtcctagcgtaacactgatgctgagacgtaaaagccccagtacagtaacg
gatttggcgatcccggctttctacactcgggccagctaccacgatgtggttaacccacaa
cttcaggaagcatcggaagcgatgattaacgaggaagcgtgggtgttgagtgacggtaaa
gcttcggttagtcaggttagtttactggctgctgcgcaaaaactgtccgatgaagcgcgc
aagtattatctgatggagtatgccaaccaatgggatgcattcttcaatgatatcagggtg
cgcccaatcaacggacttgatgatgcggcgctgctggcaagacaactctcagacccgtca
tccccgttggctaatctggtgcgtttctccacacgtgaaataaccctgaccactgacaac
aatggtaaaggggcgatgtcgtcaggctggttcaatattcaacgtaataagctcacgact
gcccgccgtaacatcattgacgaaatgtcgggtgagcgttctcgttttcgtctaacgcca
gagaaagcggtggaggatcgctttgaactattaagacgtctgggatatgccctgcaaagt
gcgtctaccagcaattctgatccgttgggccgaaccttcgagcagatttataaccagttg
ataacactctcgacttcccttcgggctgggcagattttgccgcaaaataacgatttcagt
cgcttgcaaatcgatatggcccgtcagccagagccggtgcgcagcattatgatggatctg
ctggccgtcggacaaacgcaaagtctgcaacaaagtaaggccaacctcagcaagggcgtc
tcttcaattgcttctgatttatgtagcaacgccgtcagtggccgttatccctttaatcgg
ttggctagcgaagagataggtattggcgatttcaaccgtatgtttggtcgttctggggcg
atgcaaagcttctttgatcagaatctcgcaccgtatgtcgataccaacggcaaccgctgg
aaggtaaaacctgacagtaacggtgtggtgacccctaaaactctgcgttcgtttgaaaac
tcagcacaaatccgcgacaccttctttgatgcctccggcaagatggcgatgtcgatgatc
attcgccctatctcactgactccatcaattttggaagcggttcttgatgtcgatggccag
attattaactacagccatggttctaaccaaccggtaaaagttgattggccaggaccgaaa
ggtggggtgtatatccgcctgacgttcaaaactcaggatggaaatgtggaaaccgttagc
ttcaatggtccgtgggctattttccgcatgtatgacgttagtaaccctaggccactcggg
gtcaatagccgtgaactcatgatggtgatggataacgtgagtggcgtcttcaaaattgag
ttgagttccaccatgaaagattatccgctgtggtcaaaagcattggcacagttctcatgt
cctaagaatctctaa

DBGET integrated database retrieval system