KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_3574Help
Entry
YPK_3574          CDS       T00665                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    YPK_3574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ACA69841
UniProt: B1JKY4
Position
3939093..3939470
Genome map
AA seq 125 aa AA seqDB search
MIEQPRICVQVQSIYVETQSIPEEERFVFAYTVTVRNLGRSNVQLLGRYWLITNSNGRQT
EVQGEGVIGEQPLILPGNEFQYTSGAVLETPLGTMEGHYEMIDHLGQAFRTVIPVFRLAI
PALIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacagccccgtatttgtgtgcaggtacaaagtatctatgtggaaacgcaatcg
atacccgaagaggagcgtttcgtcttcgcctataccgttactgttcgtaatttagggcgt
tcaaacgtgcaactgcttggccgctattggttaattaccaatagcaatggccgccagact
gaagttcagggagaaggggttatcggcgaacaaccacttatcctgccaggtaatgaattt
caatacaccagcggtgccgttctggaaaccccgctgggtactatggaaggacattatgaa
atgattgatcaccttggacaggccttccgtactgtaattccggtattccgcttagcgatc
ccagccctgatccattaa

DBGET integrated database retrieval system