KEGG   Yersinia pseudotuberculosis YPIII: YPK_3626Help
Entry
YPK_3626          CDS       T00665                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
ypy00240  Pyrimidine metabolism
ypy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    YPK_3626
Enzymes [BR:ypy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     YPK_3626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ACA69893
UniProt: B1JL36
Position
complement(4001297..4002619)
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGQPLSEEEIRFFINGIRDNVVSEGQIAALAMTIYFHDMSMPERVALT
MAMRDSGTVLNWKSLNLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNAFRKIIQNVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYSLSADLAQAIVGVANGAGCKTTALLT
DMNQVLASSAGNGVEVREAVRFLTGEYRNPRLLEVTMALCVEMLLSGGLAHDEADARAKL
QAVLDNGKAAEVFGRMVAAQKGPVDFVERYDSYLPVATLSKPVFAEQTGIITAMDTRALG
MAVVALGGGRRRATDPIDYSVGLTEMARLGTRVDGQQPLAVIHANNEDDWQQAAEAVRAA
ITLGNNAPEETPVIYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctggcacaagaaattatccgtaaaaaacgcgacggtcagccattgagcgaagaa
gagattcgtttttttatcaatgggatccgcgataacgttgtttctgaagggcaaattgcc
gctttagcgatgaccatttatttccacgatatgagtatgcctgagcgcgttgcgctgacc
atggcgatgcgtgattccggtactgtgctgaattggaagagcctgaatctgaatggcccg
ctggtcgataagcactccactggtggcgtgggtgatgtgacgtcactgatgcttggcccg
atggtggcagcttgcggcggctatgtgccgatgatctctggccgtggtcttggtcatacc
ggcggcacactggataaactggaggcgatccccggttttgatattttcccggatgataat
gcgttccgcaaaattattcagaatgttggtgtggcgattatcggccaaaccagctcgctg
gcccctgccgataagcgtttttacgcgacccgcgatattacggcaacagtagattctatt
ccattgattacggcctctatcctggccaaaaaattggcggaagggctggatgcattggtc
atggacgtgaaggtcggctccggtgcctttatgccaacctactcgttgtcggctgatttg
gcgcaggcgattgttggtgtggcaaacggggcgggttgcaaaaccacggcgctcctgacg
gacatgaaccaagtcctggcatccagcgccggtaatggggtcgaagtccgcgaagctgtg
cgtttcctgacgggcgaatatcgcaacccacgtttgctggaagtgactatggcgctgtgt
gttgaaatgttgctgtcaggcggtttagcgcacgatgaagccgatgcccgtgccaagctg
caagccgttttggataacggcaaagcggcagaagtctttggccgcatggtggccgcgcaa
aaaggcccggtagactttgttgaacgctatgacagctacctgcccgttgctaccctaagc
aaaccggtatttgctgaacagacgggaatcattactgcaatggatacccgcgccttgggt
atggcggtggtcgccctcggcgggggacgccgtcgggcaacggatcccattgattatagt
gtagggctgacggaaatggcccgcttgggtacccgtgttgacgggcagcagccacttgcg
gtgatccatgccaataacgaagatgactggcaacaggcggcagaggctgtgcgtgcggcc
atcaccttagggaataacgcgccagaagaaacgccagtgatttatcgccgtatcactgaa
taa

DBGET integrated database retrieval system