KEGG   Yersinia pseudotuberculosis YPIII: YPK_3999Help
Entry
YPK_3999          CDS       T00665                                 

Definition
(GenBank) Phospholipase A(2)
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
ypy  Yersinia pseudotuberculosis YPIII
Pathway
ypy00564  Glycerophospholipid metabolism
ypy00565  Ether lipid metabolism
ypy00590  Arachidonic acid metabolism
ypy00592  alpha-Linolenic acid metabolism
ypy01100  Metabolic pathways
ypy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypy00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YPK_3999
   00565 Ether lipid metabolism
    YPK_3999
   00590 Arachidonic acid metabolism
    YPK_3999
   00591 Linoleic acid metabolism
    YPK_3999
   00592 alpha-Linolenic acid metabolism
    YPK_3999
Enzymes [BR:ypy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     YPK_3999
    3.1.1.32  phospholipase A1
     YPK_3999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: ACA70262
UniProt: A0A0H3B866
Position
complement(4411197..4412075)
Genome map
AA seq 292 aa AA seqDB search
MARFWQILIALLLVPTLAQAEEATIEKIHDAPAVRGSIIAAMLQDHDNPFLLYPYETNYL
LYTYTNEINKQAISSYDWAEQANKDEVKFQLSLAFPIWRGIAGDNSLLGASYTQRSWWQA
SNSEESSPFRETNYEPQLFLAWSTDYELAGWTFREVEFGFNHQSNGKADPTSRSWNRVYT
RVMAQRGNLEIDLKPWYRIPESDSKDDNPDITKYMGYYRLKVGYALGDSVFSLDGRYNWN
TGYGGAEMGWSYPITKHVRFYTQVFSGYGESMIDYNFRQTRVGVGIMLNDVL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcgagattttggcagatactgattgcgttattactggtgccaacattggcacaggct
gaagaagcaacgattgaaaagattcatgatgcgcccgcagtgcgtggcagtattatcgcg
gcaatgttgcaggaccacgataatcctttcctactttatccgtatgaaaccaactatttg
ctctacacctataccaacgagatcaataaacaagccattagctcgtatgattgggctgaa
caggcgaataaagatgaagtaaaattccaactgagtttagctttccctatctggcgtggt
attgccggggataactcattattgggggcttcttatacccagcgttcatggtggcaggca
tccaacagtgaagaatcttcaccttttcgtgaaaccaactacgagccacagctgtttttg
gcgtggtcaacagattacgaattggctggctggactttccgcgaagtcgaatttggtttt
aaccatcaatccaacggtaaagctgacccaacctcacgtagttggaaccgtgtttatacc
cgcgtgatggcacaacgtggcaatttggaaatcgacctgaagccttggtatcgtattcct
gaaagcgacagtaaagatgataaccctgatattacgaaatacatggggtattatcgcctg
aaagtcggctatgccctgggtgacagcgtattcagccttgatggtcgctataactggaat
accggttacggtggcgcggaaatgggctggagctacccaattaccaaacatgttcgcttc
tatactcaggtattcagtggctacggtgagtcaatgattgactataactttaggcaaaca
cgggtgggtgtaggtatcatgttgaacgatgtcctttaa

DBGET integrated database retrieval system