KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_4146Help
Entry
YPK_4146          CDS       T00665                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Pathway
ypy00540  Lipopolysaccharide biosynthesis
ypy01100  Metabolic pathways
Module
ypy_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    YPK_4146
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ypy01005]
    YPK_4146
Enzymes [BR:ypy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     YPK_4146
Lipopolysaccharide biosynthesis proteins [BR:ypy01005]
 Unusual sugar
  YPK_4146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 adh_short ThiF
Motif
Other DBs
NCBI-ProteinID: ACA70405
UniProt: B1JQW4
Position
4578898..4579830
Genome map
AA seq 310 aa AA seqDB search
MIIVTGGAGFIGSNIVKALNNIGYKDILVVDNLKDGTKFVNLVDLDIADYMDKEDFVASI
VAGDDMGDIDAIFHEGACSSTTEWDGKYMMDNNYQYSKDILHFCLDRSIPFLYASSAATY
GGRTDNFIEDRQYEQPLNVYGYSKFLFDQYVREILPQADSQICGFRYFNVYGPREGHKGS
MASVAFHLNNQINAGERPKLFAGSENFKRDFIYVGDVADVNLWFWQNGVSGIFNCGTGRA
ESFQAVADAVVDYHQSGPVEYIEFPEKLKGRYQAYTQADLTKLRAAGYGKPFKTVAEGVK
EYLAWLNRSV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgttacaggcggcgcaggtttcattggcagcaatatagttaaggctctgaat
aatattggctacaaagatattctggtggttgataacctcaaagacggcactaaattcgtc
aatctggttgatctggatatcgctgattacatggataaagaagattttgtcgccagtatt
gttgcgggtgatgacatgggcgatatcgatgctattttccacgaaggcgcgtgttcttcc
accaccgagtgggatggcaagtacatgatggataacaactatcagtattctaaagatatc
cttcacttctgtctggatcgtagtattcctttcttatacgcctcttctgccgccacttac
ggtgggcgcactgacaactttattgaagatcgtcagtacgaacagccacttaacgtttat
ggctattccaaattcttgtttgatcagtatgtgcgtgaaattctgccacaagccgattcg
caaatttgtggattccgttatttcaacgtttatggtccacgtgaaggccataagggcagc
atggccagcgtcgctttccatctgaataaccaaattaatgcaggtgaaaggcctaagtta
ttcgcgggtagcgaaaactttaaacgtgatttcatttatgtgggtgatgttgctgacgtt
aatctgtggttctggcaaaacggcgtatccggtattttcaactgcggtactggccgggca
gagtctttccaggctgtcgctgatgcagtggtggattatcaccaaagtgggccagtcgaa
tacatcgagttccctgaaaaactgaaaggccgctatcaggcatatacacaagccgatctc
actaaattacgggctgccggttatggtaaaccgtttaaaacggtcgctgaaggcgttaaa
gaatatctggcctggctcaatcgctcagtctaa

DBGET integrated database retrieval system