KEGG   Yersinia pestis Z176003: YPZ3_0053Help
Entry
YPZ3_0053         CDS       T01210                                 

Gene name
rfaD
Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
ypz  Yersinia pestis Z176003
Pathway
ypz00540  Lipopolysaccharide biosynthesis
ypz01100  Metabolic pathways
Module
ypz_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:ypz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    YPZ3_0053 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ypz01005]
    YPZ3_0053 (rfaD)
Enzymes [BR:ypz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     YPZ3_0053 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:ypz01005]
 Unusual sugar
  YPZ3_0053 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 adh_short ThiF
Motif
Other DBs
NCBI-ProteinID: ADE62963
Position
complement(69008..69940)
Genome map
AA seq 310 aa AA seqDB search
MIIVTGGAGFIGSNIVKALNNIGYKDILVVDNLKDGTKFVNLVDLDIADYMDKEDFVASI
VAGDDMGDIDAIFHEGACSSTTEWDGKYMMDNNYQYSKDILHFCLDRSIPFLYASSAATY
GGRTDNFIEDRQYEQPLNVYGYSKFLFDQYVREILPQADSQICGFRYFNVYGPREGHKGS
MASVAFHLNNQINAGERPKLFAGSENFKRDFIYVGDVADVNLWFWQNGVSGIFNCGTGRA
ESFQAVADAVVDYHQSGPVEYIEFPEKLKGRYQAYTQADLTKLRAAGYGKPFKTVAEGVK
EYLAWLNRSV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgttacaggcggcgcaggtttcattggcagcaatatagttaaggctctgaat
aatattggctacaaagatattctggtggttgataacctcaaagacggcactaaattcgtc
aatctggttgatctggatatcgctgattacatggataaagaagattttgtcgccagtatt
gttgcgggtgatgacatgggcgatatcgatgctattttccacgaaggcgcgtgttcttcc
accaccgagtgggatggcaagtacatgatggataacaactatcagtattctaaagatatc
cttcacttctgtctggatcgtagtattcctttcttatacgcctcttctgccgccacttac
ggtgggcgcactgacaactttattgaagatcgtcagtacgaacagccacttaacgtttat
ggctattccaaattcttgtttgatcagtatgtgcgtgaaattctgccacaagccgattcg
caaatttgtggattccgttatttcaacgtttatggtccacgtgaaggccataagggcagc
atggccagcgtcgctttccatctgaataaccaaattaatgcaggtgaaaggcctaagtta
ttcgcgggtagcgaaaactttaaacgtgatttcatttatgtgggtgatgttgctgacgtt
aatctgtggttctggcaaaacggcgtatccggtattttcaactgcggtactggccgggca
gagtctttccaggctgtcgctgatgcagtggtggattatcaccaaagtgggccagtcgaa
tacatcgagttccctgaaaaactgaaaggccgctatcaggcatatacacaagccgatctc
actaaattacgggctgccggttatggtaaaccgtttaaaacggtcgctgaaggcgttaaa
gaatatctggcctggctcaatcgctcagtctaa

DBGET integrated database retrieval system