KEGG   Yersinia pestis Z176003: YPZ3_0311
Entry
YPZ3_0311         CDS       T01210                                 

Definition
(GenBank) hypothetical protein
Organism
ypz  Yersinia pestis Z176003
SSDB
Motif
Pfam: DUF4400
Other DBs
NCBI-ProteinID: ADE63221
Position
365028..365684
AA seq 218 aa
MFFASLFVSLVIEYVGMAFFWPELGASHSEAVMNTELGYLSSEFTRSLLLSEPSVTVTRW
IMMAYQWTFVDSGFLDWIQRAYDTQVHSQNAVARELNSWSGWLAATLKEYLVATVYVTVI
TLVRTTILVLSIPLFVLVVLVALTEGLGRRDVRRYGAGYESSFVYHHAKRMVKPAVYIPC
MLYLSWPTAVYPNLLLLPAAILLGVAVTVTTASFKKYL
NT seq 657 nt   +upstreamnt  +downstreamnt
atgttttttgcctcgttgtttgtgagcctggtgattgaatatgtcgggatggccttcttc
tggccagagctgggtgcgtcgcacagtgaagccgtgatgaacaccgagttggggtacctg
tcatcggagtttacgcgcagcttgctgctgtctgaaccttcggtgactgtcacccgctgg
attatgatggcgtatcaatggaccttcgtggacagcggctttttggactggatccaacgt
gcgtatgacacgcaggtgcacagccagaatgccgtggccagggagctgaacagttggagt
ggttggttggccgccacgctcaaagagtacctggtggcgacggtctatgtcaccgtcatc
accctggtgcggacgactattttggtgctatctatcccgctgtttgtcctggtggtgtta
gtcgcgttgacggaaggcctggggcggcgtgatgttcggcgttatggcgctggctatgaa
tcgagctttgtctaccatcatgctaaacgcatggtaaagccggcagtgtacattccctgc
atgctgtatctgtcctggccaaccgcggtataccccaatttgttgctgttgccagcggct
attttgctcggtgttgcggtgacagtgaccacagcctccttcaaaaaatacctgtag

DBGET integrated database retrieval system