KEGG   Yersinia pestis Z176003: YPZ3_0312
Entry
YPZ3_0312         CDS       T01210                                 

Definition
(GenBank) hypothetical protein
Organism
ypz  Yersinia pestis Z176003
SSDB
Motif
Pfam: Plasmid_RAQPRD
Other DBs
NCBI-ProteinID: ADE63222
Position
365919..366248
AA seq 109 aa
MTISVVRGLGAGCLLGLTLLTALPAQAAEKDELASAQRMLIQVQAALERARVAAVQADPS
ERGRFFFDYARATADLKTINAGIDRYLEPSRAQPRGGSAVAGNYRRERP
NT seq 330 nt   +upstreamnt  +downstreamnt
atgactatctccgttgttcgcggtctcggtgccggctgtttgctgggactgactctgctg
accgcactgcctgcccaggctgctgaaaaagatgagctggcgtctgcccagcgcatgttg
attcaggtgcaggcggcgcttgaacgtgcacgcgttgccgccgttcaggctgacccgtct
gagcgtggccgtttcttctttgactatgcccgcgccactgccgacctcaagaccatcaat
gccggtattgaccgctacctcgagccttcacgcgcgcaaccccgtggtggcagcgccgtg
gctggcaactaccggcgggagcgtccctga

DBGET integrated database retrieval system