KEGG   Yersinia pestis Z176003: YPZ3_0315
Entry
YPZ3_0315         CDS       T01210                                 

Definition
(GenBank) hypothetical protein
Organism
ypz  Yersinia pestis Z176003
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: ADE63225
Position
367298..367969
AA seq 223 aa
MSRFRHAVKNRDQHILTLRIACGVLVVFLLVASIGWMRAPDNLTIHNPPDLRSGSTRAWW
EVPPSTVYSFGFYIFQQLNAWPKNGEADFPAKIAALSPYLTDSCARFLKADAKKRSESGE
LAGRTRVVFEIPEHGYNGRYNPSPVTVKGRDNWVVRLDLVADESFAGEPVKRALTRYPLK
VVRAEGDPERNEFGLALDCYDSMPQRLAAAPAEPAPEKKGVFQ
NT seq 672 nt   +upstreamnt  +downstreamnt
atgagccgtttcagacatgcggttaaaaaccgcgaccagcacattctcacgttgcgcatt
gcctgcggtgtgctggttgttttccttctggtggccagcatcggctggatgcgagcaccg
gataacctgactatccataatccccccgacctgcgcagcggctctacccgcgcctggtgg
gaggttcccccctccacggtttacagttttggtttctacattttccagcagctcaatgcc
tggccaaagaacggtgaggcggatttcccggccaaaattgccgcgctgtccccttatctg
acggactcctgcgcacgcttcctgaaggcggatgccaaaaaacgcagcgaaagtggtgag
ctcgccggcaggacgcgcgtggtgttcgaaatccccgagcatggttacaacggccgttat
aacccgagtccggtgacggtgaaaggccgtgataactgggtagtgcgccttgacctggtg
gcggatgagtctttcgccggcgaaccggtgaaacgcgccctgacacgctacccactgaaa
gtggtgcgcgcagaaggggatccggaacgtaatgagttcggtctggccctggattgttac
gacagcatgccacagcgtttggctgcggcgccggcggaacccgcgcctgagaagaaagga
gtattccaatga

DBGET integrated database retrieval system