KEGG   Yersinia pestis Z176003: YPZ3_0316
Entry
YPZ3_0316         CDS       T01210                                 

Definition
(GenBank) hypothetical protein
Organism
ypz  Yersinia pestis Z176003
SSDB
Motif
Pfam: DUF3438
Other DBs
NCBI-ProteinID: ADE63226
Position
367966..368877
AA seq 303 aa
MMKARVLALSLSVLPLAATFTVPVAQAEELMKWERIPLQIPLVVGKERVLFADKNVRVGF
PPALNGKLRVQSSGGAVYLKADAAFPPTRLQLQDVENGEVILLDVTASDKGSAEPVRIVY
SGDVSSISSSNDTATSSAGSPSAAPGAENGTQAKRKKIKYNAPLPVVLTRYAAQSLYGPV
RTVEAVPGIHPVNPHLPKRITTLYPSEPVAITPLGGWGIGSRNVVALMVQNTASRKITLD
PRMLQGQFVTATFQHRYLGPVGTPEDTSTLYLVTAGRPDGAFVAEPSVVRKAVKAAKKGA
NHG
NT seq 912 nt   +upstreamnt  +downstreamnt
atgatgaaagcacgtgttctggcgctttccctgagtgtgcttcccctggcggcgacgttc
accgtaccggtagcccaggcggaagagctgatgaaatgggagcgtatcccgttacaaatc
ccgctggtcgtcggcaaggagcgggtgctgtttgccgataaaaatgtccgcgtcggcttc
ccgccggcgctaaacggcaagctgcgggtgcaaagcagtggcggtgcggtttacctgaaa
gccgatgcggctttcccgccaacgcgtctgcagctgcaggacgtggaaaacggggaggtt
attctcctcgatgtgacggcatcggacaaaggctccgccgagccggtgcgtattgtctac
agcggtgatgtgtcgtcgatcagtagcagtaatgataccgcgacctcgtcagccgggagc
ccttcggcagcgcctggggcggaaaacggcacccaggcgaagcgtaaaaaaatcaaatac
aacgccccgctgccggtggtgctgacacgctacgcggcacaaagcctgtacggtccggtg
cgtacggttgaagcggtgcccggcattcatccggttaacccgcacctgccgaaacgtatc
actaccctgtacccgtcagagccggtggccatcacgccgctgggcggctggggtattggc
agtcgcaacgtggtggcgttgatggtgcagaacactgccagccgtaaaatcacgctcgat
ccccggatgctccaggggcaatttgtgacggcgaccttccagcaccgttacctggggcct
gttggcaccccggaggacacctccacgctgtacctggtcaccgccggtcgcccggacggg
gcgtttgttgcggagccgtcagtggttcgcaaagctgtaaaagcagcgaagaagggggca
aaccatggctga

DBGET integrated database retrieval system