KEGG   Yersinia pestis Z176003: YPZ3_0319
Entry
YPZ3_0319         CDS       T01210                                 

Definition
(GenBank) hypothetical protein
Organism
ypz  Yersinia pestis Z176003
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG DUF853 SfsA FtsK_SpoIIIE
Other DBs
NCBI-ProteinID: ADE63229
Position
370948..373806
AA seq 952 aa
MRFSLFDKKRLTRKKPAVPATDVQDTVIATEDGVPLSVNGREPLRRPGKMTVKDEQQVYH
ANPSIVDYLPWAEFLDREQCILLDDGVSVGAVFDITPVATEGRTDDRLEQMRDTVEDALQ
DSFDEHDENPWVVQFFCQDENNVDAYLDRLRGYIKPHAQGSQLSESWLKETERHMRGIAR
PEGLFKDTLITDQPWRGQQRRTRMVVYRWIGKGNTDPMPPIAMLNQTCERVTGALNGAGV
VCVRQNGGQVHDWLLRHFNPSPEWVDKGTLYRDATYFDRRDTPEGAMPVQNDFAETLLFT
PPVSDPDQGVWWFDNQAHCAIPVEKLRRPPEPGTLTGEQKRGEKKINALMDMFPEGTMVC
MTIVVQPQDTLETDFNKLSKNAVGENTESGRVRQDVAQVKEYLGNRHKLYRAGITFLLRA
GDLTTLNHKRVDLTNVLLGAGLQPVRPEFDVAPLNTYLRALPMCFNPEADKKHWYTRLTW
VQHLAGLLPVTGRETGTGNPGLSFFNRGGDILTVDPLNKHDRSQNAHMLYFGPTGAGKSA
TLCATLTQTMAIHRPRLFIAEAGNSFGLLADYFESQGLTVNKISIKPGSGVSLPPFSFAH
KLIEELSSLELDESELRDIDADDEDEDKRDYLGEMEISARMMITGGDQKEEAELKRADRA
MIREALLMAAKSAFDEQRQMLPSDLQNALYAISNDTANEKRNPQRRAKAAEMAEALGMFT
QAGSFEAELFNREGSLWPEADVTLIDLGHLAREGYEAQMALTMVSLTNTINNIAERDQYS
ARDIVFAVDEAHIVTVNPLLAPYMTKIVKMWRKLGAWLWLATQNLKDFPDIAEKMLNMAE
WWVCLTMPPEEVNDIARFKALTEEQKAVLLSASKLSGCYTEGVVLSKKLEALFRAVPPSL
YLALGMTEKEEKAERRALMQEFGCSELEAARKVAQKLDRLRGLAANGEAAVA
NT seq 2859 nt   +upstreamnt  +downstreamnt
atgcgattttccctgtttgacaaaaagcgcctgacgcgcaagaagccggcagtgccggca
acggatgtccaggacacggtgatcgccaccgaggacggcgtgccgctgtccgtcaatggg
cgtgagccgttacggcgtccaggcaagatgacggtaaaagatgagcagcaggtgtatcac
gccaatccgtccatcgttgattacctgccctgggcggagtttctcgaccgtgaacagtgt
attttgctcgatgacggtgtgtccgtcggggctgtttttgatattacgccggtggccacc
gagggacgcacggacgatcgcctggagcaaatgcgcgacacggtggaagacgccctgcag
gactcgtttgacgagcatgacgaaaacccctgggtggtgcagttcttctgccaggatgag
aacaacgtcgatgcgtatcttgaccggctgagagggtatatcaagccgcatgcgcagggc
tctcaactgtctgagtcctggctgaaagaaaccgagcgccatatgcgcggtattgctcgt
ccggaaggtctgttcaaagacacgctgatcaccgatcagccatggcgtgggcagcaacgc
cggacccgcatggtggtgtaccgctggattggcaagggcaacaccgacccaatgccgcct
atcgccatgctgaatcagacctgtgagcgcgtgacgggggcgctgaacggggcaggtgtg
gtgtgtgtgcggcaaaatggcggccaggttcacgactggctgctgcgccattttaatccc
agccctgagtgggtggataaagggacgctgtaccgtgacgccacctattttgaccgccgt
gacacaccggaaggcgccatgccggtgcagaacgattttgccgaaaccctcctgttcacc
ccgcccgtgtccgatccggaccagggggtgtggtggttcgataatcaggcgcattgtgcc
attccggtcgagaagctgcgccggccgccagagccgggcaccctcaccggtgagcagaag
cgtggcgagaagaaaatcaacgcgctgatggatatgttcccggaagggacaatggtctgc
atgaccatcgtggtgcagccgcaggacacgctcgaaaccgattttaacaagttgtccaag
aacgccgtcggtgagaataccgaatccgggcgcgtgcgtcaggatgtggcacaggtcaag
gaatacctgggtaatcgccacaagctgtaccgtgccggcatcaccttcttgttgcgtgcc
ggcgacctgaccacgctcaatcacaaacgtgtcgatctgaccaacgtgctgctcggcgcc
ggcctgcagccggtacggccggagtttgatgtggcgccgctcaacacctacctgcgggcg
ttgccgatgtgttttaacccggaggcggacaagaaacactggtacacccgcctgacctgg
gtacagcatctggccggcctgttgccggtgaccgggcgtgaaacgggaacgggcaacccc
ggactgagttttttcaaccgcggtggcgatattctgacggttgatccgctcaacaaacat
gaccgcagccagaatgcgcatatgttgtattttggtccgaccggcgcggggaaatctgcg
acgttgtgtgccacgctgacgcaaaccatggcgatacatcggcctcgtctgttcattgct
gaagcgggcaactcgtttgggttgctcgctgattactttgaaagccaggggctgacggtc
aataaaatcagcatcaaaccgggcagtggcgtgtctctgccgccgttctctttcgcacat
aagcttattgaggagctgagttcactggagctggatgaaagtgagttgcgtgatattgat
gcggacgacgaagatgaggataaacgcgattatctgggggagatggagatctcggcgcgc
atgatgatcaccggcggtgaccagaaggaagaagcggagttaaaacgggctgaccgggca
atgatccgcgaagccttgctgatggcggcgaaaagcgcctttgacgaacagcgccagatg
ttaccgtctgatttgcagaacgccttgtacgctatttctaacgacacggccaacgaaaag
cgcaatccacagcgtcgggcgaaagcggccgaaatggcggaagcgctgggcatgtttacc
caggcaggcagcttcgaggcggagctgtttaaccgtgaaggtagcctgtggccagaggcg
gatgtcaccctgattgacctgggacatctggcgcgtgaggggtatgaggcgcagatggcg
ctgacgatggtgagcctgaccaacaccatcaacaacattgccgaacgagatcagtactcg
gcgcgggacatcgtgttcgcggtggatgaggcgcacatcgtgacggtgaaccccctgctg
gcgccgtacatgaccaaaatcgtcaaaatgtggcgtaagctcggcgcctggctgtggctg
gccacacagaacctgaaggacttcccggacattgccgagaagatgctgaacatggcggag
tggtgggtctgtctgaccatgccgccagaggaagtcaacgacattgcccgcttcaaggcg
ctgaccgaggagcaaaaagcggtgttgctgtctgccagtaagctgtccggttgctatacc
gaaggcgtggtgctgtcgaaaaaactcgaggcgctgttccgggcggtaccgccgagcctg
tacctggcactggggatgaccgagaaagaagagaaggccgagcgccgcgcgctgatgcag
gaatttggttgcagcgagctcgaagcggcccgcaaggtggcgcaaaagcttgaccgcctg
cgtggcctggcggcgaacggggaggcagcggtagcatga

DBGET integrated database retrieval system