KEGG   Yersinia pestis Z176003: YPZ3_0323Help
Entry
YPZ3_0323         CDS       T01210                                 

Definition
(GenBank) hypothetical protein
Organism
ypz  Yersinia pestis Z176003
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParB
Motif
Other DBs
NCBI-ProteinID: ADE63233
Position
379964..381445
Genome map
AA seq 493 aa AA seqDB search
MNNTMNKSLWGRRSLLSLLIAGSLMLAGVNAHADDNDDNGTLFGISLPQVNDSNVGYGKS
ASGAVSDKLFYSLGGGSVISQPATRGNMQRLGMNLGWSSDLMCGNFDLKTTIGNQLNGVT
DGFKNLMGSVIQGATGAVGSLPAMAIQRANPGLYEMLTNGVLQGGVAFDKAQLNCQNLSK
RMMDMADSGGWSQAAAMEEAKSLINNGDADAVRSMNATEKVTGQSGQTWIGGQKRGGAGQ
PAIKPTHDLAAAGYNMMNALPVTSTSSVSGSSCTGGACAKYASSEEAAAAVVKVLGDSSL
RTCKDAAQCTSGEGSEQPGSTVAGTGFAPMLEEATKENNEQLAKLVNGAEKPTAANLAKL
KTGSLAVTAGVIKALQRDPDNAALVGRLASELAMADTIETAFIMRRMVTTGMSEPNAAVQ
KMAMEEGDRRIEALDREITALKNEMEMKREISRNAVLTIIDRENNRAETNPQRQSVDSPD
TKFNQLAVPESDQ
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaataacacaatgaataaatctctttggggacggcgcagcctgctttctctgctgatt
gccggcagcctgatgctggccggcgtgaacgcgcacgctgacgacaatgacgataacggc
accctgtttggtatttcgttgccccaggtgaatgacagcaacgtggggtacgggaagagc
gccagcggcgcggtctcggacaagctgttttactccctgggcggcggctcggtgatttcg
cagccggcgacgcgcggcaacatgcagcggctgggtatgaacctgggctggagctcggat
ttgatgtgcggcaactttgatctgaagaccaccattggcaaccagctcaacggggtgacg
gacggcttcaagaacctgatgggcagtgttatccagggcgccaccggtgcggtgggcagc
ctgccggcgatggctatccagcgcgccaatccgggactgtatgaaatgctgaccaacggg
gtgctgcagggcggtgtcgcgttcgataaggcgcaactgaactgtcagaacctctccaag
cggatgatggatatggcggactccggcggctggagccaggccgccgcgatggaggaagcc
aagagcctgatcaataacggggatgccgatgcggtgcggtcgatgaatgccacggagaaa
gtgactggacaatccggccagacctggatcggtggtcagaagcggggtggagccggccag
ccggccatcaagcccacgcatgacctggcggccgccggctataacatgatgaatgcgctg
ccggtcaccagtacctccagcgtatccggcagcagctgcaccggtggtgcctgtgccaaa
tatgccagcagtgaagaagcggcagctgccgtggtgaaggtgttgggggattcctccctg
cgcacctgtaaagatgcggcacaatgcaccagcggggaaggcagcgaacagccaggcagt
actgtggccggcaccggctttgccccgatgctggaagaggcgacgaaggagaataacgag
cagttggccaaactggtcaacggggcagagaaacccaccgcggccaacctggccaaactc
aaaacgggcagcctggcggtgacagccggcgtcatcaaggcactgcagcgcgacccggat
aatgctgctctggtcggccgcctggccagtgaactggcgatggctgacaccattgaaacg
gcctttatcatgcgccgtatggtcaccaccggcatgtcagagcccaatgccgcagtccag
aaaatggcgatggaagagggcgatcggcgtatcgaagcgctggaccgcgaaatcacggcg
ctgaaaaacgagatggagatgaaacgcgagatttcccgtaacgcggtgctgaccatcatc
gatcgcgagaacaaccgtgcggaaaccaacccgcagcgtcagtcggttgacagcccggac
accaagttcaaccagctggccgtaccggaaagcgaccagtaa

DBGET integrated database retrieval system