KEGG   Yersinia pestis Z176003: YPZ3_0487Help
Entry
YPZ3_0487         CDS       T01210                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ypz  Yersinia pestis Z176003
Pathway
ypz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPZ3_0487
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypz02044]
    YPZ3_0487
Secretion system [BR:ypz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPZ3_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: ADE63397
Position
589453..589971
Genome map
AA seq 172 aa AA seqDB search
MAALVDYFLHIEGVDGESPDQQYNGWIQVQAWQWAEENAGRWGLGGGGGSGKVEMKDFEF
RMVSNKASPKLFLMCAIGEHIPQAKLVCRKSGQGQQDFLIVTFSNCLVSSFKTVGNMPLG
KGDAVFTDTVLPTDAISLNFARIEVEYKEQQPDGSMGAVIKAGYDLKLNSRI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcagctttagtcgattactttctccatatcgaaggtgtagatggtgagtctcccgat
cagcagtataacggatggatccaagtacaggcttggcaatgggcggaggagaatgcgggg
cgctgggggctaggtggcggtggtggttctgggaaagtcgaaatgaaggacttcgaattt
cgcatggtgagtaacaaagcatcaccaaaactatttttgatgtgtgccatcggtgaacac
attccgcaggccaagttggtgtgtcgtaaatcaggtcaaggtcaacaagacttcctgatt
gttaccttcagtaactgtctggtgtcctcctttaaaactgtcggcaacatgcctcttggt
aaaggggacgcagtattcaccgacacggtgctgccaacggatgccatcagccttaacttt
gcacgtatcgaagtggaatacaaagagcagcaacctgatggctcgatgggggccgtgatt
aaggctggttacgatctgaaattgaacagccgtatttaa

DBGET integrated database retrieval system