KEGG   Yersinia pestis Z176003: YPZ3_0489
Entry
YPZ3_0489         CDS       T01210                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
ypz  Yersinia pestis Z176003
Brite
KEGG Orthology (KO) [BR:ypz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypz02044]
    YPZ3_0489
Secretion system [BR:ypz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPZ3_0489
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ADE63399
Position
590521..592365
AA seq 614 aa
MPNESFLALYNEELRYLREDGQRFAHMHPQVAQHLGLHADGVLDPFVERLLEGTAFLSSR
IQQRLNNEHPEFALQMLGRLAPLWYTPLPSIATIAMVPDLTSPQWHSRVVLPKGSRVTLS
DSSLNNRLANFSTGRTLKIQPLVIENAECASTPPAYLPLSVASQLQAGQAHLRLRLTTQG
VASLSELDFAPMNLTLAGGIIQSNQLITTLLNNTLHIVLWANTDGKPLVKVLTKEHLRQG
GLDEQEALLPVAISEMPGNRLLREYFAAPSRFFDLELHGLNDFLQQGDGIHTFEVLFVLD
QRPLHLIDRVTGNDFRLFATPIINLFKRRCSPVLINGEHTEYPVIVDPLNPRLYEVHHVL
GVNGLLSEGGSVQFSSLHGHARFDDDDKMAGYSIRRRRDFTDKNHQKNSPLPHDSLFIAL
SPGTSGIDIDHVKSLSIEAMVCERHLIPSQLQHPEFKLEIALPVGQIEMLRHPAKPQGVP
NIDQAWRALQLIANNPLRYALPDVTDCSPLLKDWLSIFCQHEEASQHKRITSLTHASVAH
NFERHTAPGPIAWSRGVEATLDFNSSHHSDKGAFLFARILHHALSEYCELGQTLRLHMQV
DGETFAKWGPVNYG
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgcccaacgaaagttttctggctctatacaacgaagagttgcgttatctgcgtgaagat
gggcagcgcttcgctcatatgcatccgcaagtcgcccaacaccttgggttacatgctgat
ggtgtgctcgatcctttcgtcgaacggctccttgaaggcaccgctttcttgagttcccgt
atccaacagcgtttgaacaacgagcatccagagtttgctttgcaaatgcttgggcgtttg
gccccactttggtatacacccctgccgtcgattgccaccattgccatggttccggatctt
acgtcaccgcaatggcactcgcgcgtcgtattgcctaaaggtagccgcgtgacattgagt
gacagttcgctgaacaaccggttggcgaatttctctactggccgcacgctgaaaatacag
ccattggtcattgaaaatgccgagtgtgccagcacgccaccggcgtatttaccgctctct
gtggcttcacaattacaagctggtcaggcccatctgcgcttgcgtctgaccactcaaggt
gtcgcgtctttatctgagctggatttcgccccgatgaacctgacgctagcggggggaata
attcagtcaaatcagttaatcacgacactgttgaataacaccttacatattgttttgtgg
gccaacacggatgggaaaccgctggtcaaagttcttaccaaagaacatcttcgccaggga
gggctggatgaacaagaggcgcttttacctgttgcgatcagcgaaatgcctggaaaccgt
ttgctacgagaatattttgctgctccttcgcgttttttcgatctggaactgcatggcctc
aacgacttcctgcaacaaggggacggcattcatacctttgaggtgctgtttgtactggat
cagcgccccctacatttgattgatagggtcactggcaatgacttccgactcttcgccaca
cctattattaacctgttcaaacgccgttgtagcccggtgctgattaatggtgaacacacc
gaatatcccgtcattgttgaccccctgaacccccgcttgtacgaagtccatcatgtactc
ggggtcaacggtttgttgagcgaaggggggagcgtgcagttttcttcccttcatggtcat
gcccgttttgatgatgacgataaaatggcgggttacagcattcgccgtcgccgcgacttc
acggataaaaatcatcagaaaaattcacctttacctcatgacagcttattcattgccctt
tcaccggggaccagcgggatagatattgatcacgtcaagtcgctgtcgattgaagccatg
gtgtgcgaacgccacttaattcccagccaattacagcatccggaattcaagctggaaatt
gccctgccagtggggcagatcgaaatgctgcgtcacccggcaaaaccacagggtgtgccg
aatattgatcaagcctggcgggcgttacaactgattgccaacaatccgctgcgttatgcg
ctgccggatgtcaccgattgttcgccgctgctaaaagattggctgtcgatattttgtcag
catgaagaggcgagccagcataagaggatcactagcctgactcacgccagtgtggcgcat
aattttgaacgtcataccgctccggggccgatcgcctggagccggggggttgaagccaca
ctggatttcaacagcagccaccacagtgataaaggtgcattcctctttgcgcggatcctg
catcacgcgctgtcagaatattgtgaattagggcagaccctgaggttacacatgcaggtt
gatggtgaaaccttcgccaaatgggggcctgtcaactatggctag

DBGET integrated database retrieval system