KEGG   Yersinia pestis Z176003: YPZ3_0500
Entry
YPZ3_0500         CDS       T01210                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ypz  Yersinia pestis Z176003
Pathway
ypz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPZ3_0500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypz02044]
    YPZ3_0500
Secretion system [BR:ypz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPZ3_0500
SSDB
Motif
Pfam: IcmF-related IcmF-related_N IcmF_C AAA_16 AAA Rad17 AAA_19
Other DBs
NCBI-ProteinID: ADE63410
Position
606369..609809
AA seq 1146 aa
MVDRAADRHWPLFPSGGVWVRKIIIALILFWALWPFVAIFFSWIFRYARAPLPKRKKKTV
QLDRVSARFHDAMLTLQHADLSSQKTRWQRWRQRRKRQYIDAKPWFLVMGPPGCGKTSIV
YESSEKFLLSEQYGLAQTTDIGPTQDCNWWLTDRAVYIDTAGEWILLHGQSEEAGTARQK
LFSMIRKYRRYPGVDGIVLCLDVSVLLNSSVTERKSLADTLRLRILEVASTFQADIAVYL
FLNNIDKLPGGETFLSLMNDELLAGGLGISMTHNEKGQNNFVADEERYRELLTRVSRYVL
EILHDSPNMEMRHQLLLFTESLGALQKPLFGLFEQIFPATPIGYTGCLRQFWFGSTQNLT
SWEALYYPSSTSTFESRPAGQMYFPALSQAITERGVLHATGPMPLRNRLLNIGKYVFVVL
VLCILLLMLSARYFWEYDYIGYATARFEETRRIVRDIPITNQVNDNLVAAYEQLGYINTH
YLESSPPLLTPYFEHRLLNQAMLQTYHRHLNKVFWPAVQNYVTNELKKDTQSPDGDNYDT
LKVYLMLGQPDHRSQEALVQWFMSRWESFAPQGYGQNDRKLFSYHLSELFSDTASAAPKV
KLNDELIRESRIKAMKTPIHIRVINRIHDAPLPARIEDLSLADAAGPSVTLMLRRKSPST
VTDLAIPAFYTRASYHDVVNPQLQEASEAMINEEAWVLSDGKASVSQVSLLAAAQKLSDE
ARKYYLMEYANQWDAFFNDIRVRPINGLDDAALLARQLSDPSSPLANLVRFSTREITLTT
DNNGKGAMSSGWFNIQRNKLTTARRNIIDEMSGERSRFRLTPEKAVEDRFELLRRLGYAL
QSASTSNSDPLGRTFEQIYNQLITLSTSLRAGQILPQNNDFSRLQIDMARQPEPVRSIMM
DLLAVGQTQSLQQSKANLSKGVSSIASDLCSNAVSGRYPFNRLASEEIGIGDFNRMFGRS
GAMQSFFDQNLAPYVDTNGNRWKVKPDSNGVVTPKTLRSFENSAQIRDTFFDASGKMAMS
MIIRPISLTPSILEAVLDVDGQIINYSHGSNQPVKVDWPGPKGGVYIRLTFKTQDGNVET
VSFNGPWAIFRMYDVSNPRPLGVNSRELMMVMDNVSGVFKIELSSTMKDYPLWSKALAQF
SCPKNL
NT seq 3441 nt   +upstreamnt  +downstreamnt
gtggtggatagggccgctgatcgccattggcccctatttccctctgggggggtatgggtt
cgtaagatcattattgctctgattttattttgggcactgtggccatttgttgcaattttc
ttcagttggatttttcgttatgcccgtgcgccacttcccaagcgcaagaaaaaaacggtt
cagcttgatcgcgtttctgcacgttttcatgatgcgatgctcaccctgcaacatgcggat
ctttcaagccagaaaacacgctggcagcgctggcgtcaacggcgtaagcgccagtatatc
gatgctaaaccgtggtttctggtcatggggccacccggatgcggtaaaacgtcgatagtt
tatgagagtagcgagaagttcctactctcagaacagtatggtttagcgcagaccacggat
attggaccgacgcaggactgtaattggtggctgacggatcgtgctgtttacatcgatacg
gcaggggaatggatcctgctgcatggtcagagcgaagaagcgggcacggctcggcaaaaa
ttgttctctatgatccgcaaatatcgccgttatccgggggttgatgggattgttctttgc
cttgacgtcagcgtgcttttgaactcttcggtgacggaacgtaagtcactggctgatacg
ttgcgcctgcggatcctggaagttgcctcgacatttcaggccgatattgcggtgtacttg
ttcctcaacaatatcgataagttacctggcggcgaaaccttcctctcgttaatgaacgac
gaacttctggccggagggcttgggattagcatgacccataatgaaaaggggcagaacaat
ttcgttgccgatgaagaacgttaccgtgaactcctgacacgtgttagccgttatgtgttg
gaaatactgcacgattcgcccaacatggagatgcgccaccaattgctgctgtttacagaa
agcctgggagcgctacaaaaacccctgtttggcttattcgaacaaatatttccggcgaca
ccgattggctataccggttgtttgcggcagttctggtttggcagtacccaaaatctgacc
tcatgggaggcgctgtattatccgtcatcgaccagcacctttgaaagccggcctgctggg
cagatgtatttccctgcactgagtcaagcgatcaccgaaaggggggtattacacgccact
ggccccatgcctttgcgaaatcgcctgttaaacatcggtaaatatgtgttcgtggtcctt
gtgctctgcatcttattgttgatgctgagcgcccgctatttttgggaatatgactatatt
ggctatgcgacagctcggtttgaggaaacccgtcggattgtgcgtgacatcccaatcacg
aatcaggtcaacgataatctggtcgcagcttacgaacagttggggtatatcaacacccat
tatctggaaagttcaccgccactgctgacaccgtacttcgagcaccgtttactgaatcag
gcgatgttgcaaacctaccatcgtcacctgaataaagtgttctggcctgcggtacaaaac
tacgtcaccaacgagctgaaaaaggacactcaatctcctgacggtgacaactatgacacg
ctgaaagtttacctgatgctcggacaacctgatcaccgctctcaggaggcattggtgcaa
tggtttatgtcgcgctgggaaagttttgcgcctcagggatatgggcaaaacgaccgcaaa
ctcttcagttatcatttgagtgaactgttttctgacaccgcctcagctgccccgaaagtt
aagctgaatgatgagctgatccgtgaatcacgcattaaagcgatgaaaacaccgatacac
atccgggtgattaatcgtattcatgacgccccactgcccgcgaggattgaggatcttagt
ctggcggatgccgccggtcctagcgtaacactgatgctgagacgtaaaagccccagtaca
gtaacggatttggcgatcccggctttctacactcgggccagctaccacgatgtggttaac
ccacaacttcaggaagcatcggaagcgatgattaacgaggaagcgtgggtgttgagtgac
ggtaaagcttcggttagtcaggttagtttactggctgcggcgcaaaaactgtccgatgaa
gcgcgcaagtattatctgatggagtatgccaaccaatgggatgcattcttcaatgatatc
agggtgcgcccaatcaacggacttgatgatgcggcgctgctggcaaggcaactctcagac
ccgtcatccccgttggctaatctggtgcgtttctccacacgggaaataaccctgaccact
gacaacaatggtaaaggggcgatgtcgtcaggctggttcaatattcaacgtaataagctc
acgactgcccgccgtaacatcattgacgaaatgtcgggtgagcgttctcgttttcgtcta
acgccagagaaagcggtggaggatcgctttgaactattaagacgtctgggatatgccctg
caaagtgcgtctaccagcaattctgatccgttgggccgaaccttcgagcagatttataac
cagttgataacactctcgacttcccttcgggctgggcagattttgccgcaaaataacgat
ttcagtcgcttgcaaatcgatatggcccgtcagccagagccggtgcgcagcattatgatg
gatctgctggccgtcggacaaacgcaaagtctgcaacaaagtaaggccaacctcagcaag
ggcgtctcttcaattgcttctgatttatgtagcaacgccgtcagtggccgttatcccttt
aatcggttggctagcgaagagataggtattggcgatttcaaccgtatgtttggtcgttct
ggggcgatgcaaagcttctttgatcagaatctcgcaccgtatgtcgataccaacggcaac
cgctggaaggtaaaacctgacagtaacggtgtggtgacccctaaaactctgcgttcgttt
gaaaactcagcacaaatccgcgacaccttctttgatgcctccggcaagatggcgatgtcg
atgatcattcgccctatctcactgactccatcaattttggaagcggttcttgatgtcgat
ggccagattattaactacagccatggttctaaccaaccggtaaaagttgattggccagga
ccgaaaggtggggtgtatatccgcctgacgttcaaaactcaggatggaaatgtggaaacc
gttagcttcaatggtccgtgggctattttccgcatgtatgacgttagtaaccctaggcca
ctcggggtcaatagccgtgaactcatgatggtgatggataacgtgagtggcgtcttcaaa
attgagttgagttccaccatgaaagattatccgctgtggtcaaaagcattggcacagttc
tcatgtcctaagaatctctaa

DBGET integrated database retrieval system