KEGG   Yersinia pestis Z176003: YPZ3_1334
Entry
YPZ3_1334         CDS       T01210                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ypz  Yersinia pestis Z176003
Brite
KEGG Orthology (KO) [BR:ypz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypz02044]
    YPZ3_1334
Secretion system [BR:ypz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPZ3_1334
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ADE64244
Position
1725910..1726410
AA seq 166 aa
MSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNIN
KNNFNSVLAEFQPSLKLAVPDTLAGDNTDTAVALTFREMKDFEPESVARQIPQLRALLAM
RNLLRDLKSNLLDNATFRRELENILKDDALSDELRAELAALAPKEG
NT seq 501 nt   +upstreamnt  +downstreamnt
atgtcctcttcaagcttccaaaatgagatacctaaagcacgcattaacatcaaattagac
ctgcatactggcggggcgcaaaagaaagtcgaactgcctttgaagttgttggtgatgggc
gattacagcaacggtcaggagcagcgcccgctgtctgaacgtgaaaaactcaatatcaat
aaaaataattttaacagtgtgctggctgaattccaaccgagcctgaaactcgctgtaccg
gacacgctggccggggataacaccgatacagccgtcgctttgaccttccgcgagatgaaa
gatttcgaaccggaaagcgtcgcccgtcaaatcccgcaactgcgtgccttgctggccatg
cgcaacctgctgcgagacctcaaatccaatctgctggacaacgccaccttccgccgtgag
ctggaaaatatcctcaaagacgatgccttgagcgatgaactgcgcgctgaactggcggcc
ctggcaccaaaagagggttaa

DBGET integrated database retrieval system