KEGG   Yersinia pestis Z176003: YPZ3_1336
Entry
YPZ3_1336         CDS       T01210                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
ypz  Yersinia pestis Z176003
Brite
KEGG Orthology (KO) [BR:ypz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypz02044]
    YPZ3_1336
Secretion system [BR:ypz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPZ3_1336
SSDB
Motif
Pfam: T6SS_VasE Phage_tail_APC
Other DBs
NCBI-ProteinID: ADE64246
Position
1728114..1729361
AA seq 415 aa
MAVMHPWGVLQATFELDALAQGRLKAARLHVRFQDGVLVDTECADVLPPTLTLAASLPAE
ASDATVMLAIPQLYANGGNCLQPDERGERPVRYRQAWRDVQNQFGDDKKQVAVMYHQLTL
RLDTQENGDYQVCPVARLLRDAQGRWTLDPGFIPPMLSLQASAWCGEQLELLMVQLRARL
QRLMGMRRESNARMADFAVADVSLFWLLNALNSAEPVLGNFQRYPQVHPERLYQELARLA
GSLLTFSLEHEVTAIPVYQHEQLTRVFPPLFALLNILLEASLPSRVVAIELVHEPRINQW
RATLRDPRLREGADFYLSVRSSLPAAQLQTQFPQLCKAGAPDEVGNVVNVALSGIPLRPL
SHVPAAIPLRLENQYFSLDLSHPAATQMMETGACVFYVPGTLGEIQLELFAVLRA
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggccgtgatgcatccctggggcgtgcttcaggccacttttgaattggatgcattggca
cagggccgcctgaaagcggcgcgtttgcatgtgcgttttcaggacggtgtgctggtggat
accgagtgtgctgatgtgctgccgcccacgctgacgctggcagccagtctgcccgccgag
gccagcgacgccacggtgatgctggcgataccacaactgtatgccaatggcggtaactgc
ctgcagccggatgagcggggcgaacgcccggtacgctatcgtcaggcctggcgcgatgtc
caaaatcagttcggcgatgacaaaaagcaggtcgcggtgatgtaccaccaactgaccctg
cggctggacactcaggaaaacggcgattatcaggtctgcccggtggcgcgtttgctgcgg
gatgcgcaaggtcgctggacactggatccgggctttattccgccgatgctgagcctgcag
gccagtgcctggtgtggcgaacagcttgagttattgatggtgcaactgcgggcgcgtttg
cagcgtctgatggggatgcgccgggagagcaatgcacggatggccgattttgctgttgcg
gatgtgtcgctgttctggctgctcaatgcccttaacagtgccgaaccggtattggggaat
tttcagcgctatccgcaggttcatccagagcgcctgtatcaggaactggccaggctggcg
ggcagcctgctgacgttctcccttgagcacgaagtgacggcgatcccggtttatcagcat
gaacaactgacccgcgtctttcccccgttgtttgccctgctgaatattctgctggaagcc
agcctcccttcacgggtagtggcgattgagctggttcatgaaccgcgtatcaatcagtgg
cgcgcgaccctgcgtgaccctcgtctgcgcgaaggggccgatttctacctgtcggtccgt
tcctcgttgcccgcggcccaattgcagactcagttcccgcagttgtgtaaagccggtgcg
ccggatgaggtcggtaacgtggtgaatgttgcgctgagtgggatcccactgcgcccgctg
agccatgtcccagccgccatccccttgcggctggaaaaccagtacttctcccttgatctc
agccaccctgcggcgacgcagatgatggagacgggggcctgtgtgttctatgtacccggt
acgctgggtgagatccaactggagctgtttgcggtgctacgcgcatga

DBGET integrated database retrieval system