KEGG   Yersinia pestis Z176003: YPZ3_1404Help
Entry
YPZ3_1404         CDS       T01210                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ypz  Yersinia pestis Z176003
Pathway
ypz00040  Pentose and glucuronate interconversions
ypz00052  Galactose metabolism
ypz00500  Starch and sucrose metabolism
ypz00520  Amino sugar and nucleotide sugar metabolism
ypz01100  Metabolic pathways
ypz01130  Biosynthesis of antibiotics
Module
ypz_M00362  Nucleotide sugar biosynthesis, prokaryotes
ypz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ypz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YPZ3_1404 (galU)
   00052 Galactose metabolism
    YPZ3_1404 (galU)
   00500 Starch and sucrose metabolism
    YPZ3_1404 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    YPZ3_1404 (galU)
Enzymes [BR:ypz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     YPZ3_1404 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADE64314
Position
1826581..1827471
Genome map
AA seq 296 aa AA seqDB search
MKCLKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYIVDECVAAGVKEIVLVSHSSK
NAIENHFDTSFELEAALESRVKRQLLKEIKNICPADVTIMQVRQGHAKGLGHAVLCAKSM
VGDNPFIVMLPDVLLDDSTADLSKENLASMIKRFEETGHSQIMVEPVPKADVSKYGIADC
GHVALAPGESTLMTAVVEKPSIAEAPSNLAVVGRYVLSKNIWPLLEKTPRGAGDEIQLTD
AIAMLMQQEPVEAFHMTGKSHDCGDKLGYMKAFVTYGVRHHTEGEKFTAWLKQQLD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtttaaaagccgtcattcctgttgctgggcttggcacccgtatgttgcccgcg
actaaagctattccgaaagaaatgctcccggtcgtcgataaacccctgatccagtatatt
gtggatgaatgtgttgccgcaggggtcaaagagatcgtactggtgagccattcatctaag
aatgcgatagagaatcattttgatacttcatttgagctggaagccgcgctggagtcacgg
gttaagcggcagttattaaaagagatcaaaaatatttgcccagcggatgtcaccattatg
caagtgcggcagggccatgctaaaggtctagggcacgcagtgttatgtgctaaatcgatg
gtgggggacaatccttttatcgtcatgctaccggatgtactactggacgattcaacggct
gatttatcaaaagaaaatcttgccagtatgattaaacgcttcgaagaaaccggtcatagc
caaatcatggttgagccagtgcccaaagcggatgtctccaaatacggtattgcggattgt
ggccatgtggcattagcaccaggcgaaagcacgttgatgacagcggtggtagaaaaaccc
tctatagccgaggccccgtctaaccttgctgtagttgggcgctatgtattgtctaaaaat
atctggccgttgcttgagaaaacaccacgtggtgcgggggatgaaattcaactgaccgat
gccattgcgatgttaatgcagcaagagcccgtagaggcatttcatatgacgggcaaatct
catgattgcggcgataaactgggctatatgaaagcttttgtgacttatggcgttcgtcat
catactgaaggtgaaaagtttactgcctggctaaaacagcaactcgattaa

DBGET integrated database retrieval system