KEGG   Yersinia pestis Z176003: YPZ3_1758Help
Entry
YPZ3_1758         CDS       T01210                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ypz  Yersinia pestis Z176003
Pathway
ypz00030  Pentose phosphate pathway
ypz00480  Glutathione metabolism
ypz01100  Metabolic pathways
ypz01110  Biosynthesis of secondary metabolites
ypz01120  Microbial metabolism in diverse environments
ypz01130  Biosynthesis of antibiotics
ypz01200  Carbon metabolism
Module
ypz_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ypz_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
ypz_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:ypz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YPZ3_1758 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YPZ3_1758 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ypz04147]
    YPZ3_1758 (zwf)
Enzymes [BR:ypz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     YPZ3_1758 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     YPZ3_1758 (zwf)
Exosome [BR:ypz04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   YPZ3_1758 (zwf)
  Exosomal proteins of colorectal cancer cells
   YPZ3_1758 (zwf)
  Exosomal proteins of bladder cancer cells
   YPZ3_1758 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ADE64668
Position
complement(2266035..2267519)
Genome map
AA seq 494 aa AA seqDB search
MAVMNTVQVAQACDLVIFGAKGDLARRKLLPSLYQLEKAGHIHPDTRIIGVGRAEWDKDA
YTAVVKEALDTFMKEPLDDELWQKLSSRLDFCNLDVNDSKHFTKLGKMLDQKHRTTINYF
AMPPSTFGAICKGLGEAGLNKEPSRVVMEKPLGTDLAPSRVINDQVAEYFNECQVYRIDH
YLGKETVLNLLALRFANSLFASNWDNRTIDHVQITVAEEVGIEGRWGYFDQAGQMRDMIQ
NHLLQILTMIAMSPPADLSTDRIRDEKVKVLRSLRRIDHTNVRETTVRGQYTAGFVQGNK
VPGYLEEEGANKNSNTETFVSIRVDIDDWRWAGVPFYLRTGKRLPSKCSEVVVYFKNPAL
NLFRESYQQLPQNKLTIRLQPDEGIEIEVLNKVPGLEHKHRLQTTKLDLSFSKTFNEQHI
ADAYERLLLETMRGIQALFVRRDEVEEAWKWVDSIMNAWAADNEAPKPYQSGTWGPVASV
AMITRDGRSWNEFE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaatgaatacagtccaggtagcccaggcgtgtgacctggtgattttcggcgct
aaaggtgatttggctcgccggaaactgctgccttctctttaccaattagaaaaagcgggt
catatccacccagatactcggataatcggtgttggccgtgctgagtgggataaagatgcg
tacaccgctgtggtaaaggaagccctcgatacctttatgaaagagccgctggatgacgag
ctatggcaaaaactcagctcgcgcctcgacttctgcaatctggatgtgaatgacagtaag
catttcaccaaattaggtaaaatgctcgatcaaaaacatcgcaccacgattaactacttt
gctatgccgccgagtacatttggtgcgatttgtaaaggcctgggagaagccgggttaaac
aaagagcctagccgagtggtaatggaaaaaccattgggaaccgatttagcgccctcaagg
gtaattaacgatcaggtagccgagtatttcaacgaatgtcaggtttaccgtattgaccac
tatttagggaaagaaacggtattaaacctgttggcgcttcgcttcgctaactcgttgttc
gcctcaaactgggacaaccgcactatcgatcatgtgcaaattaccgtcgcagaagaggtc
ggaattgaagggcgttggggctattttgatcaggccggtcagatgcgtgacatgatccaa
aaccatctgttgcaaatcctgacgatgatcgccatgtcaccccccgcagatctcagtacg
gatcgcatccgtgatgaaaaagtaaaagtactgcgttcgctgcgccgtattgatcacacc
aatgtgcgcgaaactacagttcgtgggcaatatactgccggctttgtacagggcaataaa
gtgccgggttatctggaagaggaaggcgcgaataagaatagcaataccgaaacatttgtg
tctattcgggtggatatcgatgactggcgttgggctggggtacctttctacctgagaacc
ggtaagcgcctacccagcaaatgctctgaagttgtggtttactttaagaaccccgcactg
aatctcttccgcgaatcttatcaacaactgccacaaaacaaactgacaattcgtttgcaa
ccggacgaagggatcgaaattgaagtgctgaataaagtccccggattggaacataagcat
cgtttacaaaccactaagcttgatctcagtttctccaaaaccttcaatgagcagcatatt
gctgatgcctatgaacgtctgctactggagaccatgcggggtattcaagcgctgtttgtg
cgccgtgatgaggtcgaagaggcgtggaaatgggtcgattctattatgaatgcgtgggcg
gcagataatgaagcaccaaaaccataccagtccggtacatgggggcctgtggcatccgtt
gctatgatcacccgtgatggccggtcatggaatgagttcgagtaa

DBGET integrated database retrieval system