KEGG   Yersinia pestis Z176003: YPZ3_2578Help
Entry
YPZ3_2578         CDS       T01210                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ypz  Yersinia pestis Z176003
Pathway
ypz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPZ3_2578
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypz02044]
    YPZ3_2578
Secretion system [BR:ypz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPZ3_2578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C Colicin_V
Motif
Other DBs
NCBI-ProteinID: ADE65488
Position
complement(3324834..3328661)
Genome map
AA seq 1275 aa AA seqDB search
MSYLNRLFSGWAMKRILLVGCFILLAAAIWFLGPFLGFGEARPLESYEARIICILLALLL
ILGFWYGAPRFVIAAVVACAAVWVIGPFILVGDDHPLTDGIRRGIIIAIIAFITLIYGTW
CLVKALAKNPALLDNFIKHKKAAKPEAEAELSEVNAMIRNGMNYVRRIHSGIPAWRRFFI
SNRWRTELPWFMVVGMKGAGKTALILSSGQDFPLPEQLNRIGKENPPTQHCECLFSNDAL
FLDTSGKYIDDSKDNQTEWTGILKALKKYRPVKAINGVIVAISASDILGKSKADLLNVSA
TLRTRLDEVRAVLGVRFPVYVTITKLDQISGFDEYFRNLTAEDREQIWGVTFPYNEAKEQ
SDMPLQQRISHELALLEDRISNNMHVRQQEEYAVADRKGMYALPQDFRMLSQRVTEVLQN
VFFASRFDETKFHTTLRGIYFVSSCQPADVELLNNNTLIQKWRNVINHKKPLSPADLSQK
SDNEDRFISDVAYGKQYFLKQLFSDVITKDADLVSYNLKVQSKYRFQNLLGHAACIGLAV
WLVWAFLVSFQHNEGYLQATGAKLSQLESTVMSYAKTSNEQILPALLNATQQLPEYGTLD
VANPELDWRYGLYTGSAISQGANTLYQFFLQKYLFPMVENQSEVTLRKTMHSGQSEEVYA
ALKLYLMLTGEGKFDRQYMIEHVTQDWQKSGKIEPYEEKSIFVGHLNTLFTLKDWRQYGQ
PADSELIKQARAILAEKTVTARLWGRIQSRLLADAPANMTLRKMVGEHATQVFTLSDDEL
LHEGIPGLYTYAGYHEVVKKKLTPLLMLLQEEDRWVMAQSLSSSLDPLTLRQDVLVMYLQ
GYAAYWKRFLSSVRLISVDADSAEYAQGLSLDIALLRTLVSENSPLLNLARQAVKETTLA
EKEKAITDEINIRTQGQLLSQAKKLQETIAFRENKLIKEWVDNRFESLRVFVNGEQSADV
TGGNNLSVLQGTQMSRIIGTLNDQYTRFVVYNSAFEYGDIPPLSQDGERIAVESQTWPDP
FRNIIAPLLTGSSQKFENKVITHTSKAIDMGVGEICRNTLQGRYPFAESEQIVSLNDFER
FFGTDGTVDSYFKKNLESKVDTSSIPWRYKGSVSSEGLAFFEQAAMIRNVLFNTNDGKKM
ALDFSVSVRYLAPTITQLIMNFDGNTVRYSHGPVTPAFFKWPGLRQGTIVSLTAQRQKAS
AMPDILFRGPWALLQWADQADEIRDEANGKQTLTYLMGKDRVELEVSGLTHGGETISDLL
RDFKCPSVNDMNGIW
NT seq 3828 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatttgaatcgattgttttctggctgggccatgaaacgcatattgctggtcggc
tgctttatattgctggctgcggcgatatggtttctggggcctttcctcggctttggtgag
gcgcggcctctcgaaagttatgaagccagaattatttgcatcctgctggcactgctgctg
atcttaggtttttggtacggcgcaccgcgctttgtcattgccgccgtcgttgcctgtgct
gcggtatgggtgattggcccattcatattagttggtgatgatcatcctctgactgatggg
atccgtcgcggcatcattatcgccatcattgcatttattacacttatttatggcacctgg
tgcttagtcaaagcattggcgaaaaatccagcgttactggataacttcattaagcacaag
aaagcggccaagcctgaagcggaggctgaactttctgaagttaatgcgatgatccgcaat
ggcatgaactatgtgcgccgtattcacagtggtattccggcctggcgacgtttctttatc
tccaaccgttggcgcacagaactgccttggttcatggttgtcggtatgaaaggtgcaggg
aaaaccgcccttatcctctcttcaggacaggactttcctttacctgagcagctgaatcgt
attggcaaagaaaacccacccactcaacattgtgaatgtttgttctctaatgacgccctg
tttttagacacttcagggaaatacattgatgacagcaaagataatcagactgagtggacc
gggatattaaaggcactcaaaaaatatcgtccggttaaggcaattaatggtgtcattgtt
gcgatttcggcatccgatatcttgggtaaaagtaaagctgatttactgaatgtgtcggcg
acgctacgcacgcgtttggatgaggttcgtgcggtcttgggcgtccgtttcccggtgtat
gtcacgattacaaaactggatcaaatatcgggttttgatgaatatttccgtaatttaacg
gctgaagatcgcgagcaaatttggggggtgactttcccttataacgaggcgaaagagcaa
tccgatatgccacttcagcaacgtatcagccatgagctggcactgcttgaggatcgtatc
agcaataatatgcacgtccgccagcaggaagagtatgccgtggcggacagaaaaggcatg
tatgcactccctcaggatttcaggatgctctcccagagggtaacggaagttttacagaat
gttttcttcgcctcacgctttgacgaaacaaaatttcacacgaccctgagagggatctat
tttgtcagcagttgtcagcctgcggatgttgaactgttaaataacaacacgctgattcaa
aagtggcgtaacgttattaatcataaaaaaccgttatcgccagccgatttatcacaaaaa
agtgataatgaagatcggtttattagcgatgtggcttacgggaaacaatatttcctcaag
cagttgtttagcgatgtgattaccaaagatgccgacttagtcagctataacctgaaagta
caatccaaataccgttttcagaatctattgggacacgcggcttgtattgggttggcagtt
tggctggtttgggccttcttggtcagcttccagcataacgaggggtatttacaggcgacc
ggtgccaagctgagtcagttagaaagcacggtgatgagttatgccaaaacgtccaatgag
cagatcttacctgcgttattgaacgcgacacagcagttacccgagtacggtacgctggat
gtggctaaccctgagcttgactggcgttatggcttatataccggtagcgcaatctcacaa
ggtgcgaacacgctctatcagtttttcttgcaaaaatatctcttcccaatggttgagaat
cagagtgaggttacattaagaaaaacgatgcactcaggtcagagcgaagaggtttatgcc
gcgctgaagctttatttgatgctgacgggtgaaggtaaatttgatcgtcaatatatgatt
gagcacgtgacccaagattggcagaaaagtggaaaaattgagccttacgaagagaagagt
attttcgtcggtcatttgaacacgctgtttaccctgaaagactggcggcagtatgggcaa
ccggcagacagtgaactgattaagcaggctcgggcaatactggcggaaaaaacagtgacc
gccagactttgggggcgtattcaatcccgcttattggccgatgcccctgccaatatgacg
ttacgtaaaatggtgggtgagcacgcgacacaggtattcaccctgtcagatgatgaacta
ctgcatgaagggatcccggggctttatacctacgcgggctaccatgaggtggttaaaaaa
aaactgacacctttgctgatgttacttcaggaagaggataggtgggtgatggcgcaatcg
ctgtcatcttctcttgaccccctgacgttaagacaagatgttctggtgatgtatttacaa
gggtatgccgcttattggaaacgctttctctccagtgttcgtctgatttctgtcgatgcg
gacagtgcagagtatgctcaagggctgtctctggatattgctttgttaaggacgttagtt
tcagaaaattcaccgctactcaatttagccaggcaggcggtaaaagaaacgacactcgcc
gaaaaagaaaaagccattactgatgagataaacatcagaacgcaagggcaattactcagc
caggctaaaaaattacaagaaacgatcgcgtttcgtgaaaataaactgattaaagagtgg
gttgataatcgttttgaatccctgagagtctttgttaatggggaacagagtgctgatgtc
acggggggcaataatctttctgttcttcagggaacgcagatgagccgaataatcgggaca
ttaaacgatcaatatacccgttttgttgtttataacagtgcctttgaatatggcgatatt
cctccgttatcccaggatggggaacgtattgcggtggaatcacaaacatggccggatccg
tttagaaatattattgcaccgttattaacgggctcatcccagaaatttgaaaataaagtg
attactcacacgtccaaagcgattgatatgggggtgggggaaatttgccggaatacgctg
caagggcgttacccatttgctgaaagtgagcaaattgttagtttgaatgattttgagcgt
ttcttcggtactgacggtacggtggacagttatttcaagaaaaacttggagagtaaagtc
gacacgtcctcaataccttggcgttataagggcagcgtaagtagtgaaggtttggcgttc
tttgaacaggcggcaatgatcagaaacgtgctatttaataccaatgacggtaaaaaaatg
gcattagatttttccgtatcagtgcgttatttagcacccactatcacccaacttattatg
aactttgatggtaatactgtgcgttattcccatggtcccgtaacgccagccttctttaaa
tggccgggtttacgtcaaggcaccattgtcagtttaacggcccaacgccagaaggcatcc
gcgatgcccgatattctttttcgcggaccttgggcactcttgcagtgggctgatcaggcc
gatgaaattcgcgatgaagcgaatggcaaacagacgctgacttatctcatggggaaagat
cgtgtcgagcttgaagtctcaggtttaacgcatggtggtgaaaccattagcgatctgctg
agagatttcaaatgccccagtgtcaatgacatgaatggtatttggtaa

DBGET integrated database retrieval system