KEGG   Yersinia pestis Z176003: YPZ3_3086
Entry
YPZ3_3086         CDS       T01210                                 

Definition
(GenBank) hypothetical protein
  KO
K11894  type VI secretion system protein ImpI
Organism
ypz  Yersinia pestis Z176003
Brite
KEGG Orthology (KO) [BR:ypz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypz02044]
    YPZ3_3086
Secretion system [BR:ypz02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   YPZ3_3086
SSDB
Motif
Pfam: FHA
Other DBs
NCBI-ProteinID: ADE65995
Position
3954823..3956139
AA seq 438 aa
MDKKQPTLSLRVVNSDKLESGKQASSLFHTQGGSVGSDGSHHWSIQDQGGNISPSQFAIE
WRDGSFCLRMLNGSLNINHSMLTPNSGFVRLQQGDEMTLGNLVIKSHISRSAADMIDPLM
VSPESLVSSYSNPMDAMMEGEPLASPHHQQDSRLAATVSHNFSHDPLRVLETESLTTQGH
DAVISDADHSLQQDRYRNPLFSSPLSDTPKDSAMDQAFIDLPQISTFLNGKQAGGKPEGL
NNQMEQHHVAITPLMRGFDAQLPIRNSQEAHDFLEEAGKTLKATIEGLLALQRSQHGLRD
KHLRPIEDNPLRLNMDYDTTLNLMFADQKSPVHLSAPAAVAESLDNLRLHHQANQQAITQ
ALNTMLEAFSPERLLTRFTHYLRSNERQEQDSAWAWDMYKNYYNELASSRQQGFEKLFGE
VYEQAYDRALRQGMKDSE
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggataaaaaacaaccaacgctgtcattgcgggtcgtcaacagcgataaattagagagt
ggcaaacaagccagcagcctgtttcatacgcaagggggcagtgtcggcagtgacggtagc
catcattggtcgattcaggaccaaggcggcaatatcagcccgtcacagtttgctattgaa
tggcgtgatggctctttctgcctgcggatgctgaatggctctctgaacattaatcattcg
atgctgacacccaattcgggtttcgttcgcctacagcaaggggatgaaatgacgttgggt
aatctggtgatcaaaagccatatcagccgttctgctgccgatatgatcgatccactgatg
gtgtcaccggagtcactggtatcgagttacagcaacccgatggatgccatgatggaaggg
gagccgttggcctcgcctcatcatcagcaagacagccggttagccgcgacggttagccat
aatttcagccatgatccattgcgggtattggaaactgaaagcctgaccacgcaaggccat
gacgccgtgatatctgatgctgatcactctctacagcaggaccgataccgtaacccactt
ttctcttccccgctctctgatacccccaaggacagtgctatggatcaggcgtttatcgat
ctcccgcagatcagtacctttcttaacggtaaacaagcggggggcaaaccagaaggatta
aataaccaaatggaacaacatcacgttgccattacgccgctgatgcgtggttttgacgct
caactcccgatccgcaacagccaggaagctcacgatttccttgaagaggcgggtaaaaca
ctcaaagcgacaatcgaaggtctgctcgccttacaacgcagccaacatggcttgcgtgat
aagcacttacggccgattgaagataatccattgcgtctgaatatggattacgacaccacc
ctcaacttgatgtttgccgatcaaaaaagcccggttcatctttcagcgcccgccgccgtg
gccgaaagcctggataacctgcgtttgcatcatcaggccaatcaacaggcgattacgcaa
gccttgaacaccatgttggaagccttctcccctgagcgtttactgacgcgttttacccat
tatttgcgcagtaatgagcggcaagagcaggactccgcctgggcgtgggatatgtacaaa
aactactataacgagctggcctccagccgccagcaaggttttgaaaaactgtttggcgaa
gtgtatgagcaagcctatgaccgggccttacgtcaaggcatgaaggatagcgagtaa

DBGET integrated database retrieval system