KEGG   Yersinia pestis Z176003: YPZ3_3087Help
Entry
YPZ3_3087         CDS       T01210                                 

Definition
(GenBank) putative lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
ypz  Yersinia pestis Z176003
Pathway
ypz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPZ3_3087
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypz02044]
    YPZ3_3087
Secretion system [BR:ypz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPZ3_3087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-ProteinID: ADE65996
Position
3956139..3956684
Genome map
AA seq 181 aa AA seqDB search
MNNARGYLLTWALCVVFLLSGCSGAWEATKKVGKVVMDPDIPVGQATDQPSTVRLTLLSD
PDTNPNEKGEAVPTEIVVVYLSENSKLLAADYDQLSSDALEKTLGKNYIDHQEYTLLPDQ
FKALDPIKLEEKNSYLGVIAHYADANRSEWKKIIKIKGIGHNYQVLVHVRSNDVDLRKEE
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacgccagaggctatctcctgacgtgggcattatgtgtggtgttcctgttgtct
gggtgcagcggtgcatgggaagccactaaaaaggtcggcaaggtggttatggaccctgat
attccggtggggcaggctaccgatcaaccctcaacggtcaggctaacattgctgtccgat
cccgataccaaccctaatgaaaaaggggaagcggtaccgactgagatagtggtggtgtac
ctaagtgaaaactccaagctgctggccgcggattatgatcagctaagcagtgacgcgttg
gagaaaacgctgggtaagaattacatcgatcatcaggaatacaccttactgcccgatcaa
ttcaaggcgctggaccctatcaagctggaagagaaaaacagctatctgggggtgattgct
cactatgccgatgccaaccgcagtgaatggaagaagatcatcaaaataaaagggatcggc
cataactaccaggttttggtccatgtcagatcaaacgatgtcgatctaaggaaagaggaa
gaataa

DBGET integrated database retrieval system