KEGG   Yersinia ruckeri Big Creek 74 (serotype O2): UGYR_01245Help
Entry
UGYR_01245        CDS       T03887                                 

Definition
(GenBank) selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
yrb  Yersinia ruckeri Big Creek 74 (serotype O2)
Pathway
yrb00450  Selenocompound metabolism
yrb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yrb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    UGYR_01245
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:yrb03016]
    UGYR_01245
Enzymes [BR:yrb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     UGYR_01245
Transfer RNA biogenesis [BR:yrb03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    UGYR_01245
 Prokaryotic Type
    UGYR_01245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AKA37147
UniProt: A0A085U8M1
Position
290663..291709
Genome map
AA seq 348 aa AA seqDB search
MTLPAIRLTQYSHGAGCGCKISPKVLETILHTEQQKFLDPRLLVGNETRDDAAVYDIGNG
VGIISTTDFFMPIVDDPFDFGRIAATNAISDVYAMGGKPIMAIAILGWPIDKLAPEVARR
VIEGGRQVCEQAGISLAGGHSIDAPEPIFGLAVTGVVSTEQVKKNSAAQAGCQLFLTKPL
GIGVLTTAEKKSKLRPEHYGVATETMCQLNKSGADFAHIQGVTAMTDVTGFGLLGHLSEI
CQGSGVQATLHFSAIPKLPAVEEYIAEGCVPGGTQRNFDSYGHLIGELSDLQRKLLCDPQ
TSGGLLLAVLPDSVDEVQGIAERHGMQLSSIGELTAACADRALIEIVE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgacattgccagcaatacgtcttacccaatacagtcatggtgccggatgtggatgtaaa
atctccccgaaagtgctggaaaccattttgcatactgagcaacagaagtttcttgatcca
cggttgttggtcggcaatgaaactcgggatgacgcggcggtatacgatatcggtaatggt
gtcggtattatcagtactaccgacttttttatgccgatcgttgacgatcctttcgatttt
ggtcgtatcgctgccaccaatgccatcagcgacgtgtatgccatgggaggaaaacccatt
atggccattgccatcctcggttggccgattgacaaactggcaccagaagtcgctcgtcgg
gtgattgaaggtgggcgtcaggtgtgcgagcaggctgggatttcgttagccggagggcac
tccatcgatgcgccagaaccgatattcggcttggctgtcaccggagtcgtcagtaccgaa
caggtgaagaaaaacagtgcggcgcaggcaggttgtcaactgtttctgaccaaaccgttg
gggattggcgtgctgaccacggcggagaagaaaagtaagctgcgaccagaacattatggt
gttgctaccgaaacgatgtgccagttgaataaatccggcgcggatttcgcccatatccag
ggcgtgactgcgatgacggatgtgacggggtttggtctgttggggcacctgagcgagatt
tgtcagggttccggcgtacaggcaacgttacatttctccgccattcctaaactgcccgca
gtggaagagtatattgccgaaggctgcgtaccgggcggtactcagcgcaactttgacagc
tacggccatctgattggagaactgtctgatttacaaagaaaactattatgcgatcctcaa
acctccggtggtttactgctcgcggtattaccggattcagtggatgaagttcagggcatt
gccgaacgtcacggcatgcagcttagctccataggtgagttgacggcggcctgcgccgat
cgcgcattaatcgagattgtagaatga

DBGET integrated database retrieval system