KEGG   Yersinia ruckeri Big Creek 74 (serotype O2): UGYR_01810Help
Entry
UGYR_01810        CDS       T03887                                 

Definition
(GenBank) amino acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
yrb  Yersinia ruckeri Big Creek 74 (serotype O2)
Pathway
yrb00350  Tyrosine metabolism
yrb00360  Phenylalanine metabolism
yrb00380  Tryptophan metabolism
yrb01100  Metabolic pathways
yrb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yrb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    UGYR_01810
   00360 Phenylalanine metabolism
    UGYR_01810
   00380 Tryptophan metabolism
    UGYR_01810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:yrb04147]
    UGYR_01810
Enzymes [BR:yrb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     UGYR_01810
    4.1.1.105  L-tryptophan decarboxylase
     UGYR_01810
Exosome [BR:yrb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UGYR_01810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AKA37252
Position
complement(417513..418934)
Genome map
AA seq 473 aa AA seqDB search
MTPDEFRRHGYAMIDLIADYRQNIEQRAVQPLTTPGEIKASLPANAPEKGEPFEDIISDV
EKLVMPGLLHWQHPNFFGYFPSNVELSSVLGDCLSTGLGVIGLSWQSSPALTEIEEVTTH
WLLKMIGLSDEWSGVIQDSASTSTLIALISARERTSDYVLMQEGILSSEAPLIVYTSPEA
HSAVNKAAMLAGLGLKNIRLIATDENHALSPLALEQAIEQDLAQGNRPCIVIATTGTTAA
TVMDPIDAMGDICQRYGLWLHVDSAMAGSAMILPEFRHLWHGIEKADSVVLNPHKWLGAA
FDCSVYCVRDTEHLIRIMSTNPSFLQSNADGQVRNYRDWGIPLGRRFRALKLWFLIREQG
VEGLQARLRRDIAHAQWLAEQIEHHKDWQLVAPLTLQTLCVRHQPVGLSDDALDTYTRTW
AEKFNQSGKGYVTPATLSGRWMVRISIGSLGTERRHVEGLWSELQALVSEITI
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgactccagatgagtttcgtcgccatggctatgccatgatcgacctgatcgccgactat
cggcaaaatattgaacagcgggcggtgcaaccgctcaccacaccgggagaaatcaaggcg
agtttacccgccaacgcaccggaaaaaggtgaaccttttgaagatattatcagcgatgtt
gaaaaactggtgatgccgggtctgttgcactggcagcatcctaattttttcggttacttt
ccctcgaacgtggaattgtcatcggtgctgggcgattgcttgagcaccggtctgggagtg
attggtttatcttggcaatccagcccggcgttgactgaaattgaagaagtgaccacccat
tggttgctgaaaatgattggtttgagtgatgagtggagtggagtcattcaggactctgcc
tcaacttccacgctgattgcgctgattagcgcccgcgaacgtacttcagattatgtgctg
atgcaggagggcatactgagcagcgaggcgccgctgatagtttacacctcgccagaagcc
catagcgcggtcaataaagccgccatgttagccggattgggtctgaaaaatatccgcttg
attgccactgatgaaaatcacgcactgtcgcctttggcgctggagcaggcaattgagcaa
gatctggcgcaaggaaaccgaccttgtatcgtcattgccaccaccggcacgacggcagcc
acagtgatggatcctattgatgccatgggggatatctgtcaacgctacggcttatggctg
catgttgattcggcaatggcgggttccgctatgattctgccagagttccgtcatttatgg
catgggatagaaaaggctgattcggtggtgcttaatccacataaatggttaggtgcagcc
tttgattgctcggtttattgcgtgcgtgatactgagcatttgattcgtattatgagcacc
aatcccagctttctacagtcaaatgccgacgggcaggtcagaaactatcgtgactggggg
attccactcgggcggcgtttccgcgcccttaaactgtggtttttaattcgcgagcaaggc
gtggaaggtttacaggcgcgtttgcgcagagatatcgctcatgctcagtggttggcagag
cagatcgaacaccacaaggactggcagttggtcgcaccattgacactacaaacgctgtgc
gttcgccatcaacccgtagggctgtctgatgatgcattggatacttacacccgaacctgg
gcggaaaaatttaatcaatcggggaaagggtatgtcacgcccgcgacattatcgggccgt
tggatggtcagaatttcaattggaagcttgggcacggaacgtcggcatgtggaaggcctg
tggtctgaattacaagccttagtcagtgagataacgatatag

DBGET integrated database retrieval system