KEGG   Yersinia ruckeri Big Creek 74 (serotype O2): UGYR_12985Help
Entry
UGYR_12985        CDS       T03887                                 

Gene name
apaG
Definition
(GenBank) heavy metal transporter
  KO
K06195  ApaG protein
Organism
yrb  Yersinia ruckeri Big Creek 74 (serotype O2)
Brite
KEGG Orthology (KO) [BR:yrb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    UGYR_12985 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AKA39214
UniProt: A0A085UBH1
Position
complement(2877844..2878221)
Genome map
AA seq 125 aa AA seqDB search
MIEQPRVCVQVQSIYVETQSIPDEERFVFAYTVTIRNLGRSNVQLLGRYWLITNSNGRRT
EVQGEGVVGEQPLILPGNEFQYTSGAVLETPLGTMEGHYHMVDHLGQAFRTVIPVFRLAI
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacagcctcgagtttgtgtgcaggtgcagagtatctatgtggaaacccaatcg
ataccggatgaagagcgctttgtcttcgcctataccgtcactattcgcaatcttgggcgt
tcaaacgttcagctacttggtcgttattggctgatcaccaacagcaatggtcgccggacc
gaagttcaaggcgaaggtgttgttggtgaacaaccgctgattttaccgggcaatgagttc
caatacaccagcggtgcggtactggaaacaccactgggcaccatggaaggtcattaccac
atggtcgatcaccttggtcaggcgttccgcacggtgattccggttttccgcctagctatt
ccaaccctgatccattaa

DBGET integrated database retrieval system