KEGG   Yersinia ruckeri Big Creek 74 (serotype O2): UGYR_16345Help
Entry
UGYR_16345        CDS       T03887                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
yrb  Yersinia ruckeri Big Creek 74 (serotype O2)
Pathway
yrb00260  Glycine, serine and threonine metabolism
yrb01100  Metabolic pathways
yrb01110  Biosynthesis of secondary metabolites
yrb01120  Microbial metabolism in diverse environments
yrb01130  Biosynthesis of antibiotics
yrb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:yrb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UGYR_16345
Enzymes [BR:yrb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     UGYR_16345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AKA39803
Position
complement(3627413..3628429)
Genome map
AA seq 338 aa AA seqDB search
MFIDLRSDTVTRPCTAMREAMANAEVGDDVYGDDPTVNALEAEGAKLSGKAAALFLPSGT
QANLVALLSHCQRGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGSLPLDKVLAA
IKPDDIHFAQTRLLSLENTHSGKVLPISYLQQAWELTREHQLALHIDGARIMNAAVALNL
PLREITQYCDTLTICLSKGLGAPVGSLLCGSADYIKRARRWRKMTGGGMRQAGILAAAGL
FALQNNVARLQQDHDNALWLERQLQQLGVEIIAPGAQTNVLYIRQSVELAAQMGAWMRER
GVLISAGPVTRMITHLNVSRADLERVVSLWREFLAAHN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgatctacgcagtgacacagtcactcgcccttgcaccgctatgcgtgaagct
atggctaatgccgaggttggcgatgacgtttatggcgatgacccgacggtcaacgcgttg
gaagccgaaggagcaaagctgtctggtaaagccgccgcactgttcttacccagtggtact
caggctaatctggtggcgttgctgagccactgtcagcgtggcgaagaatatattgttggg
cagaaagctcataattatctgtatgaagctggcggtgccgctgtgctcggcagtattcag
ccacagccgattgatgccaatgatgacggcagcctgccgctggataaagtcctggccgcc
attaaaccggatgatattcattttgcacaaacgcgcctgctcagcttggaaaatacccac
agtggtaaagtcctaccgataagttacctgcaacaagcgtgggaattgacccgtgaacac
cagttggcgctgcatattgatggcgcgcggattatgaatgcggcagtggcgctgaatctg
ccactgcgggaaataacccaatattgcgatacgctgaccatctgtctttccaaagggtta
ggagcgccggtgggttcactgctatgcgggagtgcagactatatcaaacgcgcacgccgt
tggcgcaaaatgaccggcggtggcatgcgtcaggccggtattctggcggcagctggtctg
tttgcactacagaacaatgtagcccgattgcagcaagaccatgataatgcgctatggctg
gaacgccaactgcagcaattgggtgtggaaattattgcaccgggtgcgcaaaccaatgtg
ctgtatatccgccagtcggttgaactcgccgcccaaatgggggcgtggatgcgtgaacgc
ggcgtgctaatcagcgccggtcctgttacccgaatgataactcacctgaatgtcagccgt
gccgatctggagcgagttgtcagcctgtggcgcgagtttcttgctgcacataactga

DBGET integrated database retrieval system